AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDS
GNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIEAVISITYTYS
The query sequence (length=132) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3bfq:G | 132 | 132 | 0.9924 | 0.9924 | 0.9924 | 1.33e-93 | 3bfw:A, 3bfw:C, 5iqm:G, 5iqm:A, 5iqn:A, 5iqn:G, 5iqo:A, 5iqo:C |
2 | 2zyo:A | 385 | 55 | 0.1212 | 0.0416 | 0.2909 | 3.7 | 2zyk:A, 2zyk:B, 2zyk:C, 2zyk:D, 2zym:A, 2zyn:A |
3 | 7m1z:B | 425 | 40 | 0.1136 | 0.0353 | 0.3750 | 4.3 | 7m1z:A, 7m1z:C, 7m1z:D, 7m3h:A, 7m3h:B, 7m66:A, 7m66:C, 7m66:B, 7m66:D |
4 | 3s7z:B | 235 | 78 | 0.1515 | 0.0851 | 0.2564 | 5.8 | |
5 | 5hzv:A | 598 | 43 | 0.1061 | 0.0234 | 0.3256 | 6.2 | |
6 | 8i01:A | 594 | 39 | 0.1061 | 0.0236 | 0.3590 | 7.9 | 8beo:A, 8beo:B, 8beo:C, 8beo:E, 8beo:D, 8beo:F, 8i01:B, 8i01:C, 8i01:E, 8i01:D, 8i01:F, 8i05:A, 8i05:B, 8i05:C, 8i05:E, 8i05:D, 8i05:F, 8i07:A, 8i07:B, 8i07:C, 8i07:E, 8i07:D, 8i07:F, 8i08:A, 8i08:B, 8i08:C, 8i08:E, 8i08:D, 8i08:F, 2pan:A, 2pan:B, 2pan:C, 2pan:D, 2pan:E, 2pan:F |