AKLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLVRLAQQNMG
The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2z3x:A | 56 | 56 | 1.0000 | 1.0000 | 1.0000 | 1.94e-34 | 2z3x:B, 2z3x:C |
2 | 4m25:B | 317 | 21 | 0.1607 | 0.0284 | 0.4286 | 2.8 | 4m25:C, 4m25:D, 4m26:B, 4m27:B, 4m2f:B, 4m2g:B, 4m2i:B, 4m2i:C, 4m2i:D, 4ne0:B, 4ne0:D |
3 | 4ne0:A | 337 | 21 | 0.1607 | 0.0267 | 0.4286 | 2.9 | 4m25:A, 4m26:A, 4m26:C, 4m26:D, 4m27:A, 4m27:C, 4m27:D, 4m2c:B, 4m2c:C, 4m2c:D, 4m2e:B, 4m2e:C, 4m2e:D, 4m2f:A, 4m2f:C, 4m2f:D, 4m2g:A, 4m2g:C, 4m2g:D, 4m2i:A, 4ne0:C |
4 | 8h3x:C | 357 | 37 | 0.2321 | 0.0364 | 0.3514 | 6.9 | 8h3y:A, 8h3y:B, 8h3y:C, 3p24:A, 3p24:B, 3p24:C, 3p24:D, 7pnd:A, 7pnd:B, 7pol:A, 7poo:A, 7poo:B, 7poq:A, 7poq:B, 7pou:A, 7pou:B, 8wem:C, 8wem:A, 8weo:B, 8weo:A |
5 | 1z7e:D | 644 | 59 | 0.2500 | 0.0217 | 0.2373 | 8.9 | 2bln:A, 2bln:B, 5j63:A, 5j63:B, 5j63:C, 5j63:D, 1z7e:A, 1z7e:B, 1z7e:C, 1z7e:E, 1z7e:F |
6 | 8om2:G | 203 | 20 | 0.1607 | 0.0443 | 0.4500 | 9.2 | 8d8k:G, 8d8l:G, 5mrc:GG, 5mre:GG, 5mrf:GG, 8om3:G, 8om4:G |
7 | 4hdr:A | 335 | 23 | 0.1786 | 0.0299 | 0.4348 | 9.3 | 4hdk:A, 4hdm:A, 4hdr:C, 4hds:A |
8 | 3khj:A | 302 | 36 | 0.2321 | 0.0430 | 0.3611 | 9.3 | 3khj:E, 3khj:F, 3khj:G |