BioLiP

>protein
AKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPSTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKD
RDGCPKIVNL

The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7dvq:6	105	90	0.9889	0.8476	0.9889	1.05e-60	7abg:y, 7abh:y, 7abi:y, 7b0i:D, 7b91:D, 7b92:D, 7b9c:D, 8ch6:D, 6en4:D, 7evn:D, 7evo:6, 6ff4:y, 8hk1:6, 8i0p:7, 8i0r:7, 8i0s:7, 8i0t:7, 8i0u:7, 8i0v:7, 5ife:D, 7omf:D, 7onb:D, 7opi:D, 7q3l:G, 7q4o:G, 7q4p:G, 7qtt:D, 6qx9:BP, 8r08:BP, 5syb:A, 5syb:B, 7vpx:6, 6y50:y, 8y7e:6, 5z56:6, 5z57:6, 5z58:6, 5zya:D
2	2k0a:A	109	91	0.5778	0.4771	0.5714	3.28e-31	7dco:5, 6g90:S, 5gm6:J, 5lqw:Y, 5nrl:S, 5zwm:5
3	5c2v:D	770	23	0.1444	0.0169	0.5652	0.058	5c2v:A, 5c2w:A, 5c2w:D
4	9bct:I	65	54	0.1667	0.2308	0.2778	0.19
5	6qf7:B	244	26	0.1222	0.0451	0.4231	2.6	6b74:B, 6b77:B, 6l63:A, 6l63:C, 6qf7:D, 8r8d:B, 8r8d:A, 6x0s:A, 6x0s:B, 6x0s:C, 6x0t:A, 6x0t:B, 6x0t:C
6	1ryq:A	64	28	0.0889	0.1250	0.2857	3.3	8oki:I, 8p2i:I, 3p8b:A, 3p8b:C, 3qqc:E
7	8j56:C	160	39	0.1889	0.1062	0.4359	4.9	8j56:F
8	3ro0:B	209	89	0.2667	0.1148	0.2697	5.5	3ro0:A, 3ro0:C, 3ro0:D
9	6cnb:B	1114	19	0.0889	0.0072	0.4211	5.9	8bws:B, 6cnc:B, 6cnd:B, 6cnf:B, 6eu0:B, 6eu1:B, 6f40:B, 6f41:B, 6f42:B, 6f44:B, 5fj8:B, 5fja:B, 6tut:B, 7z0h:B, 7z1l:B, 7z1m:B, 7z1n:B, 7z1o:B, 7z2z:B, 7z30:B, 7z31:B
10	6ukj:A	350	71	0.2222	0.0571	0.2817	7.8

[Back]