AIRRNMAVFSMSVVSKLTDLTPRQIRYYETHELIKPERTEGQKRLFSLNDLERLLEIKSLLEKGFNIKEIKQIIYD
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7tea:B | 78 | 76 | 1.0000 | 0.9744 | 1.0000 | 3.34e-51 | 7tea:E, 7tea:A, 7tea:C |
2 | 4r4e:B | 84 | 73 | 0.5395 | 0.4881 | 0.5616 | 4.09e-25 | |
3 | 7tec:A | 72 | 69 | 0.5132 | 0.5417 | 0.5652 | 1.16e-21 | |
4 | 4r24:B | 85 | 68 | 0.3816 | 0.3412 | 0.4265 | 6.94e-14 | 4r22:B |
5 | 1r8d:A | 109 | 67 | 0.2895 | 0.2018 | 0.3284 | 9.86e-06 | 1r8d:B |
6 | 4wlw:A | 130 | 67 | 0.2763 | 0.1615 | 0.3134 | 1.39e-05 | 7c17:G, 7c17:H, 6ldi:G, 6ldi:H, 1q05:A, 1q05:B, 4wls:A, 4wls:B, 6xh7:G, 6xh7:H, 6xh8:G, 6xh8:H |
7 | 5c8d:E | 280 | 59 | 0.2895 | 0.0786 | 0.3729 | 2.62e-05 | 8c31:A, 8c31:B, 8c31:C, 8c31:D, 8c32:A, 8c32:B, 8c32:C, 8c32:D, 8c33:A, 8c33:B, 8c33:C, 8c33:D, 8c34:A, 8c34:B, 8c34:C, 8c34:D, 8c35:A, 8c35:B, 8c35:C, 8c35:D, 8c36:A, 8c36:B, 8c36:C, 8c36:D, 8c37:A, 8c37:B, 8c37:C, 8c37:D, 8c73:A, 8c73:B, 8c73:C, 8c73:D, 8c76:A, 8c76:B, 8c76:C, 8c76:D, 5c8a:A, 5c8a:B, 5c8a:C, 5c8a:D, 5c8d:A, 5c8d:B, 5c8d:C, 5c8d:D, 5c8d:F, 5c8d:G, 5c8d:H, 5c8e:A, 5c8e:B, 5c8e:C, 5c8e:E, 5c8e:F, 5c8e:G, 5c8e:D, 5c8e:H, 5c8f:A, 3whp:A |
8 | 5gpe:D | 129 | 62 | 0.2763 | 0.1628 | 0.3387 | 4.94e-05 | 5gpe:A, 5gpe:B, 5gpe:C, 5gpe:E, 5gpe:F, 5gpe:G, 5gpe:H |
9 | 6jni:A | 145 | 62 | 0.2632 | 0.1379 | 0.3226 | 7.76e-05 | 6jgw:B, 6jgw:A, 6jgx:A, 6jgx:B, 6jni:B, 6jni:H, 6jni:C, 6jni:D, 6jni:E, 6jni:F, 6jni:G, 6jyw:A, 6jyw:B |
10 | 2vz4:A | 100 | 69 | 0.2763 | 0.2100 | 0.3043 | 7.99e-05 | |
11 | 3d6y:A | 277 | 68 | 0.2763 | 0.0758 | 0.3088 | 0.036 | 1bow:A, 7ckq:G, 7ckq:I, 3d6z:A, 3d70:A, 3d71:A, 1exi:A, 1exj:A, 3q1m:A, 3q2y:A, 3q3d:A, 3q5p:A, 3q5r:A, 3q5s:A, 1r8e:A |
12 | 4ua1:B | 125 | 66 | 0.2895 | 0.1760 | 0.3333 | 1.5 | 4ua1:A |
13 | 5d8c:B | 128 | 70 | 0.2105 | 0.1250 | 0.2286 | 1.9 | 5d8c:A, 5e01:A, 5e01:B |
14 | 8re3:A | 445 | 51 | 0.2237 | 0.0382 | 0.3333 | 2.5 | 8re2:A, 8re3:B |
15 | 2wwf:C | 212 | 20 | 0.1711 | 0.0613 | 0.6500 | 2.6 | 2wwf:A, 2wwf:B, 2wwg:A, 2wwg:B, 2wwg:C, 2wwh:A, 2wwh:B, 2wwh:C, 2wwi:A, 2wwi:B, 2wwi:C, 2yof:A, 2yof:B, 2yof:C, 2yog:A, 2yog:B, 2yoh:A, 2yoh:B |
16 | 8foe:B | 370 | 33 | 0.1842 | 0.0378 | 0.4242 | 3.1 | |
17 | 1vz0:B | 192 | 59 | 0.2237 | 0.0885 | 0.2881 | 3.7 | 1vz0:A, 1vz0:C, 1vz0:D |
18 | 2a9y:A | 351 | 35 | 0.1579 | 0.0342 | 0.3429 | 3.9 | 2a9z:A, 2aa0:A, 2ab8:A, 2abs:A, 1dgm:A, 1lii:A, 1lij:A, 1lik:A |
19 | 8foc:B | 450 | 33 | 0.1842 | 0.0311 | 0.4242 | 4.1 | 6di2:A, 6di6:A, 6dtv:A, 6dtz:A, 6du0:A, 8fod:B, 8foh:B, 8foj:B, 8fok:B, 3lgb:A, 3lgb:B, 7tl2:A, 7tl3:A, 7tl4:A |
20 | 2iv7:A | 370 | 32 | 0.1579 | 0.0324 | 0.3750 | 4.7 | 2iw1:A |
21 | 3gka:B | 351 | 31 | 0.1184 | 0.0256 | 0.2903 | 4.9 | 3gka:A |