AIPESRLMALGILGGLAGIYASAVNPVIGPVLASLGAVCAIVWGADAIRRVASYGLGTGVPSIGYMSVSIGIVGVVAGLA
SVFVVPAIAVPVVALILAMILGVVVAVLGKKIVKMKIPILEKCTAEISGAAALSVLGFSAAIAGSYTLQTMLTSVITTGF
IGLLFILNTMAIQHPFNACLGPNENQTRTLKLAASTGFISMAIVGLLGIGLNPSWWLVSLIGALCWIVAFRAFVSASFEE
AASVKWSGLWPKE
The query sequence (length=253) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8q3v:C | 254 | 253 | 1.0000 | 0.9961 | 1.0000 | 1.70e-176 | 8q3v:c, 8q3v:S, 8q54:C, 8q54:c, 8q54:S |
2 | 8frp:F | 223 | 112 | 0.1028 | 0.1166 | 0.2321 | 0.36 | |
3 | 7sqc:1A | 1639 | 56 | 0.0791 | 0.0122 | 0.3571 | 1.0 | |
4 | 7sqc:1C | 1700 | 56 | 0.0791 | 0.0118 | 0.3571 | 1.1 | 7sqc:1D |
5 | 7sqc:1B | 1660 | 56 | 0.0791 | 0.0120 | 0.3571 | 1.1 | |
6 | 3k6x:A | 322 | 30 | 0.0435 | 0.0342 | 0.3667 | 7.6 | 3cfx:A, 3cfx:B, 3k6w:A, 3k6x:B |
7 | 8kie:y | 363 | 45 | 0.0553 | 0.0386 | 0.3111 | 8.6 | |
8 | 8frn:F | 289 | 109 | 0.0988 | 0.0865 | 0.2294 | 8.6 | |
9 | 6yw5:BB | 290 | 37 | 0.0474 | 0.0414 | 0.3243 | 9.5 | 6ywe:BB, 6ywx:BB, 6ywy:BB |