AIEFNIQESKILKGVYIITPNKFRDLRGEIWTAFTSKAVDKLLPNGLKFIHDKFIHSKHNVIRGIHGDVKTYKLATCVYG
EIHQVVVDCRKDSPTYLKYEKFIINQDNQQIILVPAGFGNAHYVTSESAVYYYKCAYKGDYVQFTYAWNDERIGIDWPTN
SPILSERDILAT
The query sequence (length=172) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8dcl:A | 185 | 176 | 1.0000 | 0.9297 | 0.9773 | 3.95e-126 | 7anj:A, 7anj:B, 8dak:A, 8dak:B, 8dcl:B |
2 | 7m15:D | 181 | 176 | 0.7965 | 0.7569 | 0.7784 | 7.02e-102 | 7an4:A, 7an4:B, 7an4:D, 7m14:A, 7m14:B, 7m14:C, 7m14:D, 7m14:E, 7m14:F, 7m15:A, 7m15:B, 7m15:C, 7m15:E, 7m15:F |
3 | 8dco:B | 181 | 175 | 0.7733 | 0.7348 | 0.7600 | 1.92e-98 | 8db5:A, 8db5:B, 8db5:C, 8db5:D, 8db5:E, 8db5:F, 8db5:G, 8db5:H, 8dco:A |
4 | 1dzt:A | 183 | 162 | 0.3198 | 0.3005 | 0.3395 | 1.89e-27 | 1dzt:B |
5 | 6c46:A | 183 | 163 | 0.3198 | 0.3005 | 0.3374 | 2.65e-23 | 6c46:D |
6 | 6ndr:A | 188 | 159 | 0.3023 | 0.2766 | 0.3270 | 9.13e-23 | 6ndr:B |
7 | 2ixh:A | 184 | 158 | 0.2791 | 0.2609 | 0.3038 | 1.36e-22 | 2ixh:B, 2ixi:B, 2ixi:A, 2ixk:A, 2ixk:B |
8 | 3ryk:A | 175 | 175 | 0.3314 | 0.3257 | 0.3257 | 1.45e-21 | 3ryk:B |
9 | 1epz:A | 183 | 166 | 0.3140 | 0.2951 | 0.3253 | 3.79e-19 | |
10 | 7pvi:AAA | 199 | 176 | 0.3081 | 0.2663 | 0.3011 | 4.02e-17 | 7pvi:BBB, 7pwb:AAA, 7pwb:BBB |
11 | 5buv:A | 174 | 173 | 0.3140 | 0.3103 | 0.3121 | 2.15e-13 | 5buv:B |
12 | 2ixc:A | 198 | 167 | 0.2500 | 0.2172 | 0.2575 | 2.53e-13 | 2ixc:B, 2ixc:C, 2ixc:D |
13 | 7pwh:AAA | 203 | 163 | 0.2616 | 0.2217 | 0.2761 | 9.53e-12 | |
14 | 1oi6:A | 202 | 176 | 0.2849 | 0.2426 | 0.2784 | 6.45e-11 | 1oi6:B |
15 | 4hn1:C | 201 | 99 | 0.1802 | 0.1542 | 0.3131 | 7.03e-08 | 4hmz:A, 4hmz:B, 4hmz:C, 4hmz:D, 4hn1:A, 4hn1:B, 4hn1:D |
16 | 2ixl:C | 197 | 131 | 0.2035 | 0.1777 | 0.2672 | 0.003 | 2ixl:A, 2ixl:B, 2ixl:D, 1nyw:A, 1nyw:B, 1nzc:A, 1nzc:B, 1nzc:C, 1nzc:D |
17 | 2b0s:L | 215 | 58 | 0.1047 | 0.0837 | 0.3103 | 0.91 | 2b1a:L, 2b1h:L |
18 | 8hic:A | 395 | 89 | 0.1512 | 0.0658 | 0.2921 | 1.7 | 7s6f:A |
19 | 7s6e:B | 400 | 89 | 0.1512 | 0.0650 | 0.2921 | 2.1 | 7s6e:A |
20 | 4fem:A | 214 | 87 | 0.1453 | 0.1168 | 0.2874 | 4.9 | 4fch:A |
21 | 6fv5:B | 382 | 73 | 0.1105 | 0.0497 | 0.2603 | 7.5 | 7b2i:A, 6fv5:A, 7ov9:A, 7ovo:A, 7ovs:A, 7owz:A |