AIAQLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPSSFSWRQAAFVD
SYCWAAVQQKNSLQSGNLPLWLHKFFPYILLLFAILLYLPPLFWRFAAAPHICSDLKFIMEELDKVYNRAIKAAPIVEQY
LKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVI
NLVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLSEGYNDLSLYNLFLEENISEVKSYKCLKVLENI
The query sequence (length=312) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6wbf:A | 344 | 325 | 1.0000 | 0.9070 | 0.9600 | 0.0 | 7f8j:A, 7f8j:G, 7f8j:B, 7f8j:C, 7f8j:D, 7f8j:E, 7f8j:F, 7f8n:A, 7f8n:B, 7f8n:C, 7f8n:D, 7f8n:E, 7f8n:F, 7f8n:G, 7f8o:A, 7f8o:B, 7f8o:C, 7f8o:D, 7f8o:E, 7f8o:F, 7f8o:G, 8gyo:A, 8gyo:B, 8gyo:D, 8gyo:E, 8gyo:F, 6wbf:B, 6wbf:C, 6wbf:D, 6wbf:E, 6wbf:F, 6wbf:G, 6wbg:A, 6wbg:B, 6wbg:C, 6wbg:D, 6wbg:E, 6wbg:F, 6wbg:G |
2 | 6uzy:A | 278 | 292 | 0.6538 | 0.7338 | 0.6986 | 2.44e-139 | 6uzy:B, 6uzy:C, 6uzy:D, 6uzy:E, 6uzy:F, 6uzy:G |
3 | 8fkp:SS | 235 | 49 | 0.0513 | 0.0681 | 0.3265 | 0.075 | 8fkq:SS, 8fkr:SS, 8fks:SS |
4 | 3cjp:A | 262 | 21 | 0.0353 | 0.0420 | 0.5238 | 0.73 | 3cjp:B |
5 | 8w9o:A | 427 | 34 | 0.0449 | 0.0328 | 0.4118 | 4.9 | 8w9o:B |
6 | 7xzh:B | 730 | 95 | 0.0769 | 0.0329 | 0.2526 | 9.9 | 7m19:C, 7xzh:A, 7xzh:C, 7xzh:D, 7xzh:E, 7xzh:F |