BioLiP

>protein
AIADVGTDRYAPYFAYAAAQPSDEVTTVRGLSNPLIKTAPVTLPFDLGQAVADNCLSLSGMGYYLGLGGCCPTCAAAEPR
LGRSDRAALVLAYVQQLNSIYEYRVFLASVAARDPSERALEEVLAHPELFFAYYVLRDGRDVRVLFFEDPDAQGALMMYV
VFPEKSVHVHHRVLDRLLGACAGHRIVAHVWQTMFVLVVRKKGDDVPAVSASDIYCKMRDISFDGELLLEYKRLYAAFED
FRPPR

The query sequence (length=245) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4z3u:B	252	245	0.9673	0.9405	0.9673	1.24e-169	5e8c:A, 5fki:1A, 5fki:1C, 5fki:1E, 5fki:1G, 5fki:1I, 5fki:1K, 5fki:1M, 5fki:1O, 5fki:1Q, 5fki:1S, 5fki:1U, 5fki:1W, 5fki:1Y, 5fki:10, 5fki:12, 5fki:14, 5fki:16, 5fki:18, 5fki:2A, 5fki:2C, 5fki:2E, 5fki:2G, 5fki:2I, 5fki:2K, 5fki:2M, 5fki:2O, 5fki:2Q, 5fki:2S, 5fki:2U, 5fki:2W, 5fki:2Y, 5fki:20, 5fki:22, 5fki:24, 5fki:26, 5fki:28, 5fki:3A, 5fki:3C, 5fki:3E, 5fki:3G, 5fki:3I, 5fki:3K, 4z3u:D
2	7pab:A	415	241	0.6204	0.3663	0.6307	5.85e-102	7pab:C
3	8g6d:B	253	249	0.5551	0.5375	0.5462	3.95e-94	8g6d:D, 8g6d:F, 8g6d:H, 8g6d:J, 8g6d:L, 4zxs:B, 4zxs:D
4	7t7i:D	242	150	0.1510	0.1529	0.2467	2.32e-07	7t7i:B, 7t7i:H, 7t7i:J
5	7t7i:F	208	150	0.1469	0.1731	0.2400	1.40e-05
6	5dob:A	237	161	0.1551	0.1603	0.2360	7.68e-04	5d5n:B, 5doc:A, 5doc:B, 5doe:B
7	5wwr:A	461	88	0.0980	0.0521	0.2727	1.1	5wwr:B, 5wws:A, 5wws:B, 5wwt:A, 5wwt:B
8	3gnr:A	478	54	0.0694	0.0356	0.3148	2.0	3wba:A, 3wbe:A
9	4yuu:V1	129	18	0.0408	0.0775	0.5556	4.4	4yuu:v1, 4yuu:V2, 4yuu:v2
10	6fxc:Ab	226	74	0.0776	0.0841	0.2568	6.1	7bge:b, 8bh6:b, 8bh7:b, 8byv:b, 6fxc:Bb, 7kwg:b, 5li0:b, 5nd8:b, 5nd9:b, 5ngm:Ab, 7nhl:c, 7nhm:c, 8p2f:c, 8p2g:c, 8p2h:c, 7p48:b, 6s0x:b, 6s13:b, 8y38:b, 8y39:b, 6yef:b
11	5j60:A	316	74	0.0816	0.0633	0.2703	8.8	5j60:D, 5j60:B, 5j60:C, 6xtf:A, 6xtf:B

[Back]