AHSAALEVLFQGPGQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFY
RRMQNSDFLRELVITIAREGLEDKYNLQLNPEWRMMKNRPFMGSI
The query sequence (length=125) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4psi:A | 125 | 125 | 1.0000 | 1.0000 | 1.0000 | 2.51e-93 | 4psi:B |
2 | 4cv4:A | 133 | 124 | 0.8080 | 0.7594 | 0.8145 | 4.45e-72 | 4ckt:A, 4ckt:B |
3 | 4cse:B | 112 | 111 | 0.7840 | 0.8750 | 0.8829 | 5.84e-71 | 4cse:A |
4 | 7kri:A | 127 | 13 | 0.1040 | 0.1024 | 1.0000 | 0.094 | 7kri:B, 7kri:C, 7n3k:A, 7n3k:B, 7n3k:C, 7n3k:D, 7n3k:E, 7n3k:F, 7n3k:G, 7n3k:H |
5 | 5o9b:A | 68 | 18 | 0.0880 | 0.1618 | 0.6111 | 0.81 | |
6 | 5cfa:B | 328 | 74 | 0.1520 | 0.0579 | 0.2568 | 3.1 | 5cf3:A, 5cfa:A |
7 | 5okn:G | 402 | 83 | 0.1840 | 0.0572 | 0.2771 | 3.6 | 6squ:A |
8 | 5okn:D | 433 | 83 | 0.1840 | 0.0531 | 0.2771 | 3.7 | 4a9c:B, 5okn:C, 5okn:E, 5okn:F, 5okn:H, 6squ:B |
9 | 2i7a:A | 157 | 29 | 0.1040 | 0.0828 | 0.4483 | 4.0 | |
10 | 6yvb:C | 324 | 12 | 0.0800 | 0.0309 | 0.8333 | 5.7 | 6ypo:A, 6ypo:B, 6ys6:B, 6ys6:C, 6ysp:A, 6ysp:B, 6ysp:C, 6yvb:A, 6yvb:B, 6yvb:D, 6yvb:E, 6yvb:F, 6yw9:A, 6yw9:B, 6yw9:C, 6ywj:A, 6ywj:B |
11 | 8fnc:8 | 516 | 70 | 0.1280 | 0.0310 | 0.2286 | 5.8 | 8fnf:8, 8fni:8, 8fnk:8 |
12 | 8st8:A | 195 | 19 | 0.0960 | 0.0615 | 0.6316 | 6.3 | |
13 | 6fxr:A | 700 | 43 | 0.1200 | 0.0214 | 0.3488 | 8.2 | 6fxk:A, 6fxm:A, 6fxt:A, 6fxx:A, 6fxy:A, 8one:A, 6te3:A, 6tec:A, 6tes:A, 6teu:A, 6tex:A, 6tez:A, 6wfv:A |
14 | 2z2p:A | 293 | 58 | 0.1200 | 0.0512 | 0.2586 | 8.5 | 2z2p:B |