Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
AHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDL

The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 3c03:A 97 80 0.9875 0.8144 0.9875 5.11e-53 3bzl:C, 3bzo:B, 3bzv:B, 3bzx:B, 3bzy:B, 3bzz:B, 3c00:B, 3c03:C
2 5cul:B 79 74 0.4125 0.4177 0.4459 1.23e-16
3 6ejp:D 90 75 0.4000 0.3556 0.4267 1.06e-13 6ejp:C
4 3c01:E 88 74 0.3000 0.2727 0.3243 8.02e-07 3c01:F, 3c01:G, 3c01:H
5 2vt1:B 81 74 0.3000 0.2963 0.3243 3.87e-06
6 4ijn:A 376 64 0.2625 0.0559 0.3281 0.85 4ijn:B
7 7dge:A 784 35 0.1750 0.0179 0.4000 1.3 1ewk:A, 1ewk:B, 1isr:A, 1iss:A, 1iss:B, 3ks9:A, 3ks9:B
8 7q8e:A 397 52 0.2250 0.0453 0.3462 2.2 6gs2:B, 6gs2:D, 6h5e:B, 6h5e:D, 7q8e:C
9 1mdx:A 366 37 0.2125 0.0464 0.4595 3.2 1mdo:A, 1mdz:A, 4oca:A
10 8p5d:SX0 140 18 0.1250 0.0714 0.5556 4.3 8p60:SX0, 8p60:RX0, 7qca:SX0
11 1oxy:A 573 34 0.1500 0.0209 0.3529 5.2
12 1nol:A 607 34 0.1500 0.0198 0.3529 5.3 1ll1:A, 1lla:A
13 5ux2:A 220 19 0.1000 0.0364 0.4211 8.8 5ux2:B
14 5c17:A 206 22 0.1000 0.0388 0.3636 9.9

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218