AGYANAADRESGIPAAVLDGIKAVAKEKNATLMFRLVNPHSTSLIAEGVATKGLGVHAKSSDWGLQAGYIPVNPNLSKLF
GRAPEVIARADNDVNSSLAHGHTAVDLTLSKERLDYLRQAGLVTGMADGVVASNHAGYEQFEFRVKETSDGRYAVQYRRK
GGDDFEAVKVIGNAAGIPLTADIDMFAIMPHLSNFRDSARSSVTSGDSVTDYLARTRRALDRERIDLLWKIARAGARSAV
GTEARRQFRYDGDMNIGVITDFELEVRNALNRRAHAVGAQDVVQHGTEQNNPFPEADEKIFVVSATGESQMLTRGQLKEY
IGQQRGEGYVFYENRAYGVAGKSLFDDGLGA
The query sequence (length=351) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1zot:A | 351 | 351 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2col:A |
2 | 1sk6:A | 481 | 362 | 0.3162 | 0.2308 | 0.3066 | 1.66e-35 | 1k90:B, 1pk0:B, 1s26:B |
3 | 1xfu:A | 735 | 362 | 0.3162 | 0.1510 | 0.3066 | 8.76e-35 | 1k90:A, 1k90:C, 1lvc:A, 1lvc:C, 1pk0:A, 1pk0:C, 1s26:A, 1s26:C, 1sk6:C, 1xfu:B, 1xfu:C, 1xfu:D, 1xfu:E, 1xfu:F, 1xfv:A, 1xfv:B, 1xfv:C, 1xfv:D, 1xfv:E, 1xfv:F, 1xfw:A, 1xfw:B, 1xfw:C, 1xfw:D, 1xfw:E, 1xfw:F, 1xfx:A, 1xfx:B, 1xfx:C, 1xfx:D, 1xfx:E, 1xfx:F, 1xfy:A, 1xfy:B, 1xfy:C, 1xfy:D, 1xfy:E, 1xfy:F, 1xfz:A, 1xfz:B, 1xfz:C, 1xfz:D, 1xfz:E, 1xfz:F, 1y0v:A, 1y0v:B, 1y0v:C, 1y0v:D, 1y0v:E, 1y0v:F |
4 | 1sk6:B | 454 | 360 | 0.3134 | 0.2423 | 0.3056 | 8.95e-35 | |
5 | 7p1g:M | 347 | 189 | 0.1909 | 0.1931 | 0.3545 | 4.04e-20 | 7p1g:K, 7p1g:L, 7p1g:N, 7p1g:O |
6 | 8bo1:B | 398 | 303 | 0.2137 | 0.1884 | 0.2475 | 9.72e-13 | 8bo1:D, 8br0:B, 8br0:D, 8br1:B, 8br1:D |
7 | 5ixg:B | 169 | 87 | 0.0826 | 0.1716 | 0.3333 | 1.5 | 5ixg:C, 5ixg:A, 5ixg:D |
8 | 4wut:A | 290 | 50 | 0.0399 | 0.0483 | 0.2800 | 7.1 |