AGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLE
The query sequence (length=82) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
3a0b:E |
82 |
81 |
0.9878 |
0.9878 |
1.0000 |
6.75e-56 |
3a0b:e, 3a0h:E, 3a0h:e, 2axt:E, 2axt:e, 5b5e:E, 5b5e:e, 5b66:E, 5b66:e, 7cji:E, 7cji:e, 7cjj:E, 7cjj:e, 7cou:E, 7cou:e, 7czl:e, 7czl:E, 7d1t:E, 7d1t:e, 7d1u:E, 7d1u:e, 6dhe:E, 6dhe:e, 6dhf:E, 6dhf:e, 6dhg:E, 6dhg:e, 6dhh:E, 6dhh:e, 6dho:E, 6dho:e, 6dhp:E, 6dhp:e, 7dxa:e, 7dxh:e, 5e79:E, 5e79:e, 5e7c:E, 5e7c:e, 7eda:E, 9evx:E, 9evx:e, 8ez5:E, 8ez5:e, 8f4c:E, 8f4c:e, 8f4d:E, 8f4d:e, 8f4e:E, 8f4e:e, 8f4f:E, 8f4f:e, 8f4g:E, 8f4g:e, 8f4h:E, 8f4h:e, 8f4i:E, 8f4i:e, 8f4j:E, 8f4j:e, 8f4k:E, 8f4k:e, 4fby:E, 4fby:R, 8gn0:E, 8gn0:e, 8gn1:E, 8gn1:e, 8gn2:E, 8gn2:e, 5gth:E, 5gth:e, 5gti:E, 5gti:e, 5h2f:E, 5h2f:e, 4il6:E, 4il6:e, 8ir5:E, 8ir5:e, 8ir6:E, 8ir6:e, 8ir7:E, 8ir7:e, 8ir8:E, 8ir8:e, 8ir9:E, 8ir9:e, 8ira:E, 8ira:e, 8irb:E, 8irb:e, 8irc:E, 8irc:e, 8ird:E, 8ird:e, 8ire:E, 8ire:e, 8irf:E, 8irf:e, 8irg:E, 8irg:e, 8irh:E, 8irh:e, 8iri:E, 8iri:e, 4ixq:E, 4ixq:e, 4ixr:E, 4ixr:e, 1izl:E, 6jlj:E, 6jlj:e, 6jlk:E, 6jlk:e, 6jll:E, 6jll:e, 6jlm:E, 6jlm:e, 6jln:E, 6jln:e, 6jlo:E, 6jlo:e, 6jlp:E, 6jlp:e, 5kaf:E, 5kaf:e, 5kai:E, 5kai:e, 3kzi:E, 5mx2:E, 5mx2:e, 7nho:E, 7nhp:E, 7nhq:E, 4pbu:E, 4pbu:e, 4pj0:E, 4pj0:e, 7rf1:E, 7rf1:e, 7rf2:E, 7rf2:e, 7rf3:E, 7rf3:e, 7rf4:E, 7rf4:e, 7rf5:E, 7rf5:e, 7rf6:E, 7rf6:e, 7rf7:E, 7rf7:e, 7rf8:E, 7rf8:e, 4rvy:E, 4rvy:e, 1s5l:E, 1s5l:e, 5tis:E, 5tis:e, 4tnh:E, 4tnh:e, 4tni:E, 4tni:e, 4tnj:E, 4tnj:e, 4tnk:E, 4tnk:e, 4ub6:E, 4ub6:e, 4ub8:E, 4ub8:e, 5v2c:E, 5v2c:e, 4v62:AE, 4v62:BE, 4v82:AE, 4v82:BE, 6w1o:E, 6w1o:e, 6w1p:E, 6w1p:e, 6w1q:E, 6w1q:e, 6w1r:E, 6w1r:e, 6w1t:E, 6w1t:e, 6w1u:E, 6w1u:e, 6w1v:E, 6w1v:e, 1w5c:E, 1w5c:K, 5ws5:E, 5ws5:e, 5ws6:E, 5ws6:e, 3wu2:E, 3wu2:e, 7yq2:E, 7yq2:e, 7yq7:E, 7yq7:e, 5zzn:E, 5zzn:e |
2 |
6jlu:E |
79 |
74 |
0.6707 |
0.6962 |
0.7432 |
3.79e-41 |
8iwh:e, 8iwh:E, 6j3y:E, 6j3y:e, 6j3z:E, 6j3z:e, 6j40:E, 6j40:e, 8j5k:E, 8j5k:e, 6jlu:e, 7vd5:E, 7vd5:e, 8wb4:E, 8wb4:e, 8xlp:e, 8xlp:E, 8xr6:E, 8xr6:e, 7y5e:EL, 7y5e:E6, 7y5e:e6, 7y5e:eL, 7y7a:E9, 7y7a:e9, 7y7a:EE, 7y7a:eE, 7y7a:EO, 7y7a:eO, 7y7a:EZ, 7y7a:eZ, 7y7a:Em, 7y7a:em |
3 |
8bd3:E |
81 |
80 |
0.6829 |
0.6914 |
0.7000 |
1.11e-40 |
8bd3:e, 6kac:E, 6kac:e, 6kad:E, 6kad:e, 6kaf:E, 6kaf:e, 7pi0:E, 7pi0:e, 7pi5:E, 7pi5:e, 7pin:E, 7pin:e, 7pin:E1, 7pin:e1, 7piw:E, 7piw:e, 7piw:E1, 7piw:e1, 7pnk:E, 7pnk:e, 8r2i:E |
4 |
8wql:ED |
78 |
78 |
0.6829 |
0.7179 |
0.7179 |
1.15e-40 |
8wql:EE, 8wql:E1, 8wql:e1, 8wql:eD, 8wql:eE |
5 |
7n8o:E |
78 |
77 |
0.6463 |
0.6795 |
0.6883 |
4.22e-39 |
8am5:E, 8asl:E, 7n8o:e, 7rcv:E, 7rcv:e, 8tow:E, 8tow:e, 6wj6:E |
6 |
8kde:E |
78 |
71 |
0.6463 |
0.6795 |
0.7465 |
3.08e-38 |
8zee:E |
7 |
3jcu:E |
79 |
76 |
0.6341 |
0.6582 |
0.6842 |
1.66e-37 |
8c29:E, 8c29:e, 3jcu:e, 5mdx:e, 5mdx:E, 7oui:E, 7oui:e, 5xnl:E, 5xnl:e, 5xnm:E, 5xnm:e, 6yp7:e, 6yp7:E |
8 |
7ymi:E |
65 |
64 |
0.5366 |
0.6769 |
0.6875 |
2.49e-32 |
7ymi:e, 7ymm:1E, 7ymm:2E, 7ymm:3E, 7ymm:4E |
9 |
4yuu:E1 |
61 |
60 |
0.5000 |
0.6721 |
0.6833 |
2.43e-30 |
4yuu:e1, 4yuu:e2 |
10 |
8eqm:E |
48 |
52 |
0.4512 |
0.7708 |
0.7115 |
1.36e-21 |
8eqm:e, 7sa3:E |
11 |
3vvp:A |
420 |
37 |
0.1463 |
0.0286 |
0.3243 |
2.3 |
|
12 |
8auv:O |
188 |
34 |
0.1098 |
0.0479 |
0.2647 |
3.8 |
8b2l:O1, 7qix:H, 7qiz:x |
13 |
5tky:A |
597 |
17 |
0.0976 |
0.0134 |
0.4706 |
6.4 |
5tky:B |
14 |
3kzi:F |
38 |
28 |
0.1098 |
0.2368 |
0.3214 |
6.7 |
3a0b:F, 3a0b:f, 3a0h:F, 3a0h:f, 2axt:F, 2axt:f, 5b5e:F, 5b5e:f, 5b66:F, 5b66:f, 7cji:F, 7cji:f, 7cjj:F, 7cjj:f, 7cou:F, 7cou:f, 7czl:F, 7d1t:F, 7d1t:f, 7d1u:F, 7d1u:f, 6dhe:F, 6dhe:f, 6dhf:F, 6dhf:f, 6dhg:F, 6dhg:f, 6dhh:F, 6dhh:f, 6dho:F, 6dho:f, 6dhp:F, 6dhp:f, 5e79:F, 5e79:f, 5e7c:F, 5e7c:f, 7eda:F, 9evx:F, 9evx:f, 8ez5:F, 8ez5:f, 8f4c:F, 8f4c:f, 8f4d:F, 8f4d:f, 8f4e:F, 8f4e:f, 8f4f:F, 8f4f:f, 8f4g:F, 8f4g:f, 8f4h:F, 8f4h:f, 8f4i:F, 8f4i:f, 8f4j:F, 8f4j:f, 8f4k:F, 8f4k:f, 4fby:F, 4fby:S, 8gn0:F, 8gn0:f, 8gn1:F, 8gn1:f, 8gn2:F, 8gn2:f, 5gth:F, 5gth:f, 5gti:F, 5gti:f, 5h2f:F, 5h2f:f, 4il6:F, 4il6:f, 8ir5:F, 8ir5:f, 8ir6:F, 8ir6:f, 8ir7:F, 8ir7:f, 8ir8:F, 8ir8:f, 8ir9:F, 8ir9:f, 8ira:F, 8ira:f, 8irb:F, 8irb:f, 8irc:F, 8irc:f, 8ird:F, 8ird:f, 8ire:F, 8ire:f, 8irf:F, 8irf:f, 8irg:F, 8irg:f, 8irh:F, 8irh:f, 8iri:F, 8iri:f, 4ixq:F, 4ixq:f, 4ixr:F, 4ixr:f, 6jlj:F, 6jlj:f, 6jlk:F, 6jlk:f, 6jll:F, 6jll:f, 6jlm:F, 6jlm:f, 6jln:F, 6jln:f, 6jlo:F, 6jlo:f, 6jlp:F, 6jlp:f, 5kaf:F, 5kaf:f, 5kai:F, 5kai:f, 5mx2:F, 5mx2:f, 7nho:F, 7nhp:F, 7nhq:F, 4pbu:F, 4pbu:f, 4pj0:F, 4pj0:f, 7rf1:F, 7rf1:f, 7rf2:F, 7rf2:f, 7rf3:F, 7rf3:f, 7rf4:F, 7rf4:f, 7rf5:F, 7rf5:f, 7rf6:F, 7rf6:f, 7rf7:F, 7rf7:f, 7rf8:F, 7rf8:f, 4rvy:F, 4rvy:f, 1s5l:F, 1s5l:f, 5tis:F, 5tis:f, 4tnh:F, 4tnh:f, 4tni:F, 4tni:f, 4tnj:F, 4tnj:f, 4tnk:F, 4tnk:f, 4ub6:F, 4ub6:f, 4ub8:F, 4ub8:f, 5v2c:F, 5v2c:f, 4v62:AF, 4v62:BF, 4v82:AF, 4v82:BF, 6w1o:F, 6w1o:f, 6w1p:F, 6w1p:f, 6w1q:F, 6w1q:f, 6w1r:F, 6w1r:f, 6w1t:F, 6w1t:f, 6w1u:F, 6w1u:f, 6w1v:F, 6w1v:f, 1w5c:F, 1w5c:L, 5ws5:F, 5ws5:f, 5ws6:F, 5ws6:f, 3wu2:F, 3wu2:f, 7yq2:F, 7yq2:f, 7yq7:F, 7yq7:f, 5zzn:F, 5zzn:f |
15 |
8qby:M |
503 |
31 |
0.1463 |
0.0239 |
0.3871 |
7.6 |
8qc1:M |
16 |
5hgq:B |
482 |
24 |
0.1463 |
0.0249 |
0.5000 |
7.7 |
5hgq:A, 5hgq:D, 5hgq:C |
17 |
8dev:B |
1043 |
35 |
0.1220 |
0.0096 |
0.2857 |
7.8 |
8deu:B, 8dew:B, 6vks:B, 6vkt:B |