AFGRATHAVVRALPESLGQHALRSGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVEDVAVVCEETALI
TRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVAD
GLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYE
KLKDHMLIPVSMSELEKVDGLLTCCSVLINKK
The query sequence (length=272) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2jaj:B | 281 | 272 | 0.9816 | 0.9502 | 0.9816 | 0.0 | 2c6z:A, 2ci6:A, 2ci7:A, 6dge:A, 3i4a:A, 3i4a:B, 2jai:A, 2jaj:A, 3p8e:A, 3p8e:B, 3p8p:A, 3p8p:B, 6szp:A, 7ulu:A, 7ulu:B, 7ulv:A, 7ulv:B, 7ulv:C, 7ulv:D, 7ulv:E, 7ulv:F, 7ulx:A, 7ulx:B |
2 | 1h70:A | 255 | 244 | 0.2721 | 0.2902 | 0.3033 | 4.38e-28 | 3bpb:A, 3bpb:B, 3rhy:A, 3rhy:B |
3 | 6k32:A | 1208 | 35 | 0.0551 | 0.0124 | 0.4286 | 0.37 | 3jb7:A, 6ty9:A, 6tz1:A, 6tz2:A |
4 | 3jb6:A | 1196 | 35 | 0.0551 | 0.0125 | 0.4286 | 0.40 | 5h0r:F, 6ty8:A |
5 | 4s28:A | 520 | 44 | 0.0588 | 0.0308 | 0.3636 | 5.1 | 4n7q:A, 4s25:A, 4s26:A, 4s26:B, 4s27:A, 4s29:A |
6 | 3ob8:A | 1024 | 19 | 0.0404 | 0.0107 | 0.5789 | 6.4 | 3ob8:B, 3ob8:D, 3ob8:C, 3oba:A, 3oba:C, 3oba:D, 3oba:B |
7 | 8sre:A | 1377 | 81 | 0.0735 | 0.0145 | 0.2469 | 6.8 | 8sr7:A, 8sr7:B, 8sr7:C, 8sr7:D, 8src:A, 8src:B, 8src:C, 8src:D, 8srd:A, 8srd:B, 8srd:C, 8srd:D, 8sre:B, 8sre:D, 8sre:C, 8srf:A, 8srf:B, 8srf:C, 8srf:D, 8srg:A, 8srg:B, 8srg:C, 8srg:D, 8srh:A, 8srh:B, 8srh:C, 8srh:D, 8sri:A, 8sri:B, 8sri:C, 8sri:D, 8srj:A, 8srj:B, 8srj:D, 8srj:C, 8srk:A, 8srk:B, 8srk:C, 8srk:D |
8 | 7l07:A | 214 | 39 | 0.0625 | 0.0794 | 0.4359 | 8.3 | |
9 | 8hl1:AEFG | 725 | 135 | 0.1287 | 0.0483 | 0.2593 | 8.4 | 8hl2:AEFG, 8hl3:AEFG, 8hl4:AEFG |