AEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAETWAMKELLTGRLVFGENLVP
EDRLQKEMERIYPGE
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2a68:O | 95 | 95 | 1.0000 | 1.0000 | 1.0000 | 1.38e-66 | 2a69:E, 2a69:O, 1iw7:E, 1iw7:O, 1smy:E |
2 | 7vlf:D | 149 | 60 | 0.1684 | 0.1074 | 0.2667 | 3.0 | 7vlc:D, 7vlc:H, 7vld:D, 7vld:H, 7vle:D, 7vle:H, 7vlf:H, 3wct:D, 3wct:H, 3wcu:D, 3wcu:H, 3wcv:D, 3wcv:H, 3wcw:D, 3wcw:H |
3 | 3qrx:A | 145 | 29 | 0.1368 | 0.0897 | 0.4483 | 5.8 | 1oqp:A |
4 | 6k0a:F | 95 | 24 | 0.1158 | 0.1158 | 0.4583 | 8.2 | 6k0b:E, 6k0b:F |
5 | 4by9:E | 227 | 27 | 0.1053 | 0.0441 | 0.3704 | 8.6 | 4by9:K, 3nmu:F, 3nmu:J, 3nvk:I, 3nvk:J |