AEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRD
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5gzb:A | 91 | 71 | 0.9324 | 0.7582 | 0.9718 | 4.72e-48 | 5nnx:A, 5no6:N, 5no6:I |
2 | 3r2q:A | 202 | 33 | 0.1351 | 0.0495 | 0.3030 | 0.70 | |
3 | 6ks6:Q | 548 | 33 | 0.1757 | 0.0237 | 0.3939 | 2.1 | 6ks6:q, 4v81:H, 4v81:P, 4v81:h, 4v81:p, 4v8r:AQ, 4v8r:Aq, 4v8r:BQ, 4v8r:Bq, 4v94:H, 4v94:P, 4v94:h, 4v94:p, 7ylw:Q, 7ylw:q, 7ylx:Q, 7ylx:q, 7yly:Q, 7yly:q |
4 | 7uoi:A | 383 | 31 | 0.1892 | 0.0366 | 0.4516 | 2.3 | 8vkt:A |
5 | 7tz4:A | 530 | 43 | 0.2027 | 0.0283 | 0.3488 | 5.0 | 7tyb:A |
6 | 7yg7:A | 414 | 41 | 0.2027 | 0.0362 | 0.3659 | 5.5 | 7yg7:B, 7yg7:C, 7yg7:D, 7yg7:E, 7yg7:F, 7yg7:G, 7yg7:H, 7yg7:I, 7yg7:J, 7yg7:K |
7 | 6rxt:UR | 447 | 34 | 0.1757 | 0.0291 | 0.3824 | 5.9 | 5oql:N, 6rxu:UR, 6rxv:UR, 6rxy:UR, 6rxz:UR |
8 | 7ezx:O3 | 375 | 17 | 0.1216 | 0.0240 | 0.5294 | 6.3 | 7ezx:OO, 6kgx:b1, 6kgx:o1, 6kgx:b4, 6kgx:o4, 7liz:A, 7y4l:Y7, 7y4l:b7, 7y5e:YP, 7y5e:bP, 7y7a:YL, 7y7a:bL, 7y7a:bU, 7y7a:YU |
9 | 7f6w:A | 506 | 32 | 0.1486 | 0.0217 | 0.3438 | 8.0 | |
10 | 1nyq:B | 645 | 18 | 0.1081 | 0.0124 | 0.4444 | 9.9 | 1nyq:A, 1nyr:A, 1nyr:B |