ADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLV
VQNVSVILCGIILMMVFLHKHELLTMYHGWVLTSCYILIITIANIANLASTATAITIQRDWIVVVAGEDRSKLANMNATI
RRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKSQMAEPFRTFRDGWVSYYNQP
VFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLISGLAQLSCLIL
CVISVFMPSVPIISVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPEAF
GLLVLISVSFVAMGHIMYFRFAQNTLGNK
The query sequence (length=429) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8dl7:A | 467 | 453 | 1.0000 | 0.9186 | 0.9470 | 0.0 | 8dl8:A |
2 | 8dl6:A | 442 | 433 | 0.9883 | 0.9593 | 0.9792 | 0.0 | 8bzy:A, 8c03:A, 6vyh:A, 6wbv:A |
3 | 5ayo:A | 406 | 423 | 0.2634 | 0.2783 | 0.2671 | 2.15e-28 | 5aym:A |
4 | 6btx:A | 377 | 424 | 0.2564 | 0.2918 | 0.2594 | 1.00e-19 | |
5 | 3u48:B | 742 | 50 | 0.0350 | 0.0202 | 0.3000 | 4.5 | 3u48:A, 3u4a:B, 3u4a:A |
6 | 8jk9:A | 195 | 80 | 0.0466 | 0.1026 | 0.2500 | 5.8 | 8jja:A, 8jjk:A, 8jk5:A, 8jk8:A, 8jka:A, 8jkp:A, 8jkr:A, 8yt5:A |