ADYKIDKEGQHAFIEFRIKHLGYSWLYGRFNDFDGSFTFDEKNPSADKVKVTINTNSVDTNHAERDKHLRSGDFLNVSKN
PTATFESTEVKANGDSADITGNLTLNGVTKPVTIKAKLIGQGDDPWGGYRAGFEGSATLKLKDFGIKMDLGPASQEVELL
LSVEGIRQ
The query sequence (length=168) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7bwl:A | 168 | 168 | 1.0000 | 1.0000 | 1.0000 | 9.08e-124 | |
2 | 1y0g:A | 169 | 168 | 0.7857 | 0.7811 | 0.7857 | 1.80e-98 | 1y0g:B, 1y0g:C, 1y0g:D |
3 | 1wub:A | 176 | 163 | 0.3214 | 0.3068 | 0.3313 | 6.58e-25 | |
4 | 5w2r:A | 171 | 164 | 0.2976 | 0.2924 | 0.3049 | 2.40e-18 | 5w2z:A, 5w30:A, 5w39:A, 5w3a:A, 5w3c:A |
5 | 3hpe:A | 164 | 166 | 0.2976 | 0.3049 | 0.3012 | 1.70e-17 | 3hpe:B |
6 | 5ixg:B | 169 | 174 | 0.3155 | 0.3136 | 0.3046 | 3.92e-15 | 5ixg:C, 5ixg:A, 5ixg:D |
7 | 5ixh:B | 161 | 92 | 0.1607 | 0.1677 | 0.2935 | 2.77e-05 | 5ixh:A |
8 | 1a8p:A | 257 | 26 | 0.0655 | 0.0428 | 0.4231 | 5.5 | |
9 | 6v39:K | 146 | 51 | 0.1190 | 0.1370 | 0.3922 | 5.5 | 7m4v:K, 7m4w:K, 7m4x:K, 7m4y:K, 7m4z:K, 7ryf:K, 7ryg:K, 7ryh:K, 7uvv:K, 7uvw:K, 7uvx:K, 7uvy:K, 7uvz:K, 7uw1:K, 6v3a:K, 6v3b:K, 6v3d:K, 6yhs:H, 6ysi:H |
10 | 3fpz:A | 311 | 51 | 0.0952 | 0.0514 | 0.3137 | 7.7 | 3fpz:B, 4y4l:A, 4y4l:B, 4y4l:C, 4y4l:D |
11 | 2cyc:A | 371 | 42 | 0.0774 | 0.0350 | 0.3095 | 9.8 | 2cyc:B |
12 | 3crz:A | 257 | 21 | 0.0655 | 0.0428 | 0.5238 | 9.9 | 2qdx:A |