BioLiP

>protein
ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPTKCGGCHIK

The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1ehj:A	68	68	1.0000	1.0000	1.0000	3.45e-44	1f22:A, 1hh5:A, 1kwj:A, 1l3o:A, 1lm2:A, 1new:A
2	3bxu:A	71	71	0.5294	0.5070	0.5070	1.44e-13	3bxu:B
3	3h33:A	72	68	0.4559	0.4306	0.4559	1.72e-12
4	3h34:A	70	69	0.5147	0.5000	0.5072	5.07e-12
5	3h4n:B	69	68	0.5735	0.5652	0.5735	9.07e-11	3h4n:A
6	4haj:A	71	71	0.4706	0.4507	0.4507	2.11e-10	4hb6:A, 4hb8:A, 4hbf:A, 4hc3:A, 4hdl:A, 2ldo:A, 2lzz:A, 2mz9:A, 2n91:A, 1os6:A, 3sel:X, 3sj0:X, 3sj1:X, 3sj4:X
7	1aqe:A	110	73	0.2941	0.1818	0.2740	0.001	1czj:A
8	3cao:A	103	87	0.3824	0.2524	0.2989	0.16	3car:A
9	1z1n:X	516	73	0.2794	0.0368	0.2603	0.16
10	1z1n:X	516	82	0.3529	0.0465	0.2927	7.0
11	1i1l:A	304	52	0.2353	0.0526	0.3077	0.29	1a3g:A, 1a3g:B, 1a3g:C, 1i1k:A, 1i1k:B, 1i1k:C, 1i1l:B, 1i1l:C, 1i1m:A, 1i1m:B, 1i1m:C, 1iyd:A, 1iyd:B, 1iyd:C, 1iye:A, 1iye:B, 1iye:C
12	1gws:A	503	47	0.2500	0.0338	0.3617	0.39	2cvc:A, 1h29:A, 1h29:B, 1h29:C, 1h29:D
13	1gws:A	503	73	0.3529	0.0477	0.3288	3.0	2cvc:A, 1h29:A, 1h29:B, 1h29:C, 1h29:D
14	2e84:A	513	49	0.2353	0.0312	0.3265	0.84
15	6f35:A	400	48	0.2059	0.0350	0.2917	0.92	6f35:B
16	2zpu:A	319	33	0.1765	0.0376	0.3636	2.3	1v71:A, 1wtc:A, 2zr8:A
17	6h5l:A	506	47	0.2206	0.0296	0.3191	3.0
18	3ov0:A	318	27	0.1471	0.0314	0.3704	3.2	3oue:A, 3ouq:A, 1rwj:A
19	5c2v:D	770	19	0.1324	0.0117	0.4737	3.6	5c2v:A, 5c2w:A, 5c2w:D
20	4cns:D	479	30	0.1912	0.0271	0.4333	4.6	4cns:A, 4cns:B, 4cns:C

[Back]