BioLiP

>protein
ADVVTYENAAGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPTKCGGCHIK

The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1ehj:A	68	68	0.9706	0.9706	0.9706	7.39e-43	1f22:A, 1hh5:A, 1kwj:A, 1l3o:A, 1lm2:A, 1new:A
2	3bxu:A	71	71	0.5147	0.4930	0.4930	6.22e-13	3bxu:B
3	3h33:A	72	68	0.4559	0.4306	0.4559	1.94e-12
4	3h34:A	70	69	0.5000	0.4857	0.4928	2.59e-11
5	4haj:A	71	71	0.4706	0.4507	0.4507	2.06e-10	4hb6:A, 4hb8:A, 4hbf:A, 4hc3:A, 4hdl:A, 2ldo:A, 2lzz:A, 2mz9:A, 2n91:A, 1os6:A, 3sel:X, 3sj0:X, 3sj1:X, 3sj4:X
6	3h4n:B	69	68	0.5588	0.5507	0.5588	5.27e-10	3h4n:A
7	1aqe:A	110	73	0.2647	0.1636	0.2466	0.041	1czj:A
8	1z1n:X	516	73	0.2941	0.0388	0.2740	0.065
9	1z1n:X	516	91	0.3824	0.0504	0.2857	7.3
10	3cao:A	103	82	0.3824	0.2524	0.3171	0.16	3car:A
11	6f35:A	400	50	0.2206	0.0375	0.3000	0.27	6f35:B
12	1gws:A	503	47	0.2500	0.0338	0.3617	0.50	2cvc:A, 1h29:A, 1h29:B, 1h29:C, 1h29:D
13	1gws:A	503	73	0.3529	0.0477	0.3288	3.5	2cvc:A, 1h29:A, 1h29:B, 1h29:C, 1h29:D
14	2e84:A	513	74	0.3088	0.0409	0.2838	0.82
15	3ov0:A	318	27	0.1471	0.0314	0.3704	1.00	3oue:A, 3ouq:A, 1rwj:A
16	1i1l:A	304	52	0.2206	0.0493	0.2885	2.4	1a3g:A, 1a3g:B, 1a3g:C, 1i1k:A, 1i1k:B, 1i1k:C, 1i1l:B, 1i1l:C, 1i1m:A, 1i1m:B, 1i1m:C, 1iyd:A, 1iyd:B, 1iyd:C, 1iye:A, 1iye:B, 1iye:C
17	6h5l:A	506	47	0.2206	0.0296	0.3191	2.7
18	5c2v:D	770	19	0.1324	0.0117	0.4737	3.6	5c2v:A, 5c2w:A, 5c2w:D
19	2zpu:A	319	33	0.1765	0.0376	0.3636	3.7	1v71:A, 1wtc:A, 2zr8:A
20	5c2v:C	314	48	0.2206	0.0478	0.3125	8.0	5c2v:F, 5c2w:C, 5c2w:F

[Back]