ADVAGTSNRDFRGREQRLFNSEQYNYNNSLNGEVSVWVYAYYSDGSVLVINKNSQYKVGISETFKALKEYRKGQHNDSYD
EYEVNQSIYYPNGGDARKFHSNAKPRAIQIIFSPSVNVRTIKMAKGNAVSVPDEYLQRSHPWEATGIKYRKIKRDGEIVG
YSHYFELPHEYNSISLAVSGVHKNPSSYNVGSAHNVMDVFQSCDLALRFCNRYWAELELVNHYISPNAYPYLDINNHSYG
VALSNRQ
The query sequence (length=247) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5axu:A | 247 | 247 | 0.9919 | 0.9919 | 0.9919 | 0.0 | 5axv:A, 5exy:A, 5exz:A, 5gqi:A, 5gqj:A, 5gql:A, 5gqm:A, 2oh5:A, 2oh6:A, 2oh7:A, 5yha:A |
2 | 5a9p:A | 248 | 247 | 0.8381 | 0.8347 | 0.8381 | 2.16e-155 | 5mqw:A, 4ots:A, 4otv:A |
3 | 5yhb:A | 178 | 238 | 0.7206 | 1.0000 | 0.7479 | 4.34e-117 | |
4 | 3pdd:A | 190 | 79 | 0.0850 | 0.1105 | 0.2658 | 0.13 | |
5 | 8tfp:A | 209 | 80 | 0.0972 | 0.1148 | 0.3000 | 1.1 | 8tfp:L, 8tfq:A, 8tfq:L, 7u09:L, 6vbq:F, 6vbq:L, 6vbq:B, 6vbq:D |
6 | 7w1i:A | 497 | 48 | 0.0648 | 0.0322 | 0.3333 | 1.2 | 7w1j:A, 7w1l:A |
7 | 3vuv:A | 276 | 32 | 0.0405 | 0.0362 | 0.3125 | 6.3 | |
8 | 3atp:A | 151 | 46 | 0.0445 | 0.0728 | 0.2391 | 7.0 | 3atp:B |