ADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLEITRSVVATTRARVCRRKYCQRPCDNLHL
CKLNLLGRCNYSNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGRQQICNQCSRLHIC
DHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQK
The query sequence (length=212) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6uej:A | 212 | 212 | 1.0000 | 1.0000 | 1.0000 | 9.29e-158 | 6uei:A |
2 | 3u9g:A | 217 | 217 | 0.8113 | 0.7926 | 0.7926 | 6.66e-125 | 6l1w:A |
3 | 2yfn:A | 719 | 49 | 0.0849 | 0.0250 | 0.3673 | 0.025 | 2yfo:A |
4 | 6pbv:D | 223 | 96 | 0.1132 | 0.1076 | 0.2500 | 0.052 | 6pbv:B, 6pbw:D |
5 | 8a22:Xd | 413 | 55 | 0.0802 | 0.0412 | 0.3091 | 1.2 | 8apn:Xd, 8apo:Xd |
6 | 7dco:M | 176 | 33 | 0.0613 | 0.0739 | 0.3939 | 1.3 | 5gm6:a |
7 | 8iuf:A9 | 484 | 33 | 0.0519 | 0.0227 | 0.3333 | 3.6 | 8j9h:A9, 8j9i:A9, 8j9j:A9 |
8 | 3nmn:D | 276 | 35 | 0.0613 | 0.0471 | 0.3714 | 4.9 | 3kdj:B, 3nmn:B |
9 | 4ii1:B | 139 | 84 | 0.0991 | 0.1511 | 0.2500 | 8.5 | 4ii1:A, 4ii1:C, 4ii1:D |