ADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQAPAPNITG
The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7vb9:c | 68 | 68 | 1.0000 | 1.0000 | 1.0000 | 9.00e-46 | 7f0l:X, 7pil:X, 7pqd:X, 7pqd:x, 7va9:C, 7va9:c, 7vb9:C, 7vnm:X, 7vny:X, 7vor:X, 7vor:x, 7vot:X, 7vot:x, 7vy2:X, 7vy2:x, 7vy3:X |
2 | 1ylh:A | 524 | 62 | 0.2794 | 0.0363 | 0.3065 | 0.028 | |
3 | 7yml:X | 65 | 59 | 0.3088 | 0.3231 | 0.3559 | 0.15 | 8b64:X |
4 | 5eiy:B | 658 | 68 | 0.3088 | 0.0319 | 0.3088 | 0.25 | 5ej1:B, 5ejz:B, 4hg6:B, 4p00:B, 4p02:B |
5 | 1os1:A | 537 | 61 | 0.2353 | 0.0298 | 0.2623 | 4.2 | 1aq2:A, 6asi:A, 6asm:A, 6asn:A, 6at2:A, 6at3:A, 6at3:B, 6at4:A, 6at4:B, 1ayl:A, 6com:A, 6crt:A, 1k3c:A, 1k3d:A, 2olq:A, 2olr:A, 2pxz:X, 2py7:X, 6v2l:A, 6v2m:A, 6v2n:A |
6 | 8yfq:R | 746 | 18 | 0.1029 | 0.0094 | 0.3889 | 4.3 | |
7 | 1l5j:A | 862 | 28 | 0.1618 | 0.0128 | 0.3929 | 7.8 | 1l5j:B |
8 | 1xl8:B | 600 | 27 | 0.1471 | 0.0167 | 0.3704 | 9.2 | 1xl8:A |