ADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEGALQDN
The query sequence (length=48) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3qoq:A | 50 | 44 | 0.9167 | 0.8800 | 1.0000 | 1.21e-26 | 3qoq:B, 3qoq:C, 3qoq:D |
2 | 1bdt:B | 53 | 43 | 0.3125 | 0.2830 | 0.3488 | 0.009 | 1bdt:A, 1bdt:C, 1bdt:D, 1bdv:A, 1bdv:B, 1bdv:C, 1bdv:D, 1par:A, 1par:B, 1par:C, 1par:D |
3 | 1xje:A | 627 | 45 | 0.2917 | 0.0223 | 0.3111 | 0.015 | 3o0n:B, 3o0o:A, 3o0o:B, 3o0q:A, 3o0q:B, 1xje:B, 1xjf:A, 1xjf:B, 1xjg:A, 1xjg:B, 1xjj:A, 1xjj:B, 1xjk:A, 1xjk:B, 1xjm:A, 1xjn:A, 1xjn:B, 1xjn:C, 1xjn:D |
4 | 3o0n:A | 607 | 21 | 0.1875 | 0.0148 | 0.4286 | 0.38 | 1xjm:B |
5 | 3vyl:A | 297 | 30 | 0.2292 | 0.0370 | 0.3667 | 0.88 | 3vyl:B, 3vyl:C, 3vyl:D, 3vyl:E, 3vyl:F, 3vyl:G, 3vyl:H |
6 | 1gkp:A | 458 | 16 | 0.1875 | 0.0197 | 0.5625 | 1.1 | 1gkp:B, 1gkp:C, 1gkp:D, 1gkp:E, 1gkp:F, 1gkq:A, 1gkq:B, 1gkq:C, 1gkq:D |
7 | 4pbg:A | 468 | 26 | 0.2083 | 0.0214 | 0.3846 | 2.1 | 4pbg:B |
8 | 4c2u:A | 658 | 31 | 0.2292 | 0.0167 | 0.3548 | 2.5 | 4c2t:A, 4c2t:B, 4c2t:C, 4c2t:D, 4c2u:D, 4c30:I, 4c30:D |
9 | 3s9f:A | 144 | 22 | 0.2083 | 0.0694 | 0.4545 | 2.9 | |
10 | 1lws:A | 427 | 26 | 0.1875 | 0.0211 | 0.3462 | 6.1 | 1ef0:A, 1um2:A, 1um2:B |
11 | 2cf5:A | 352 | 16 | 0.2292 | 0.0312 | 0.6875 | 6.7 | 2cf6:A |
12 | 7ms8:A | 146 | 21 | 0.1875 | 0.0616 | 0.4286 | 8.1 | 7ms1:A, 7ms3:A, 7ms9:A, 7ms9:B, 7ms9:H, 7ms9:I, 7ms9:K |
13 | 3vti:C | 305 | 38 | 0.2500 | 0.0393 | 0.3158 | 8.2 | 3vti:D |
14 | 4iqj:D | 1185 | 35 | 0.2500 | 0.0101 | 0.3429 | 8.8 | 3e0d:A, 3e0d:B, 2hpi:A, 2hpm:A, 4iqj:B, 4iqj:C |
15 | 4iqj:A | 1164 | 35 | 0.2500 | 0.0103 | 0.3429 | 8.9 |