AAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYA
The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6evq:A | 70 | 56 | 0.9821 | 0.7857 | 0.9821 | 2.66e-34 | 6evq:B, 3gjo:A, 3gjo:B, 3gjo:C, 3gjo:D, 5n74:A, 5n74:B, 5n74:C, 5n74:D, 5n74:E, 5n74:F, 5n74:G, 5n74:H, 7olg:A, 7olg:B |
| 2 | 5m9e:B | 71 | 47 | 0.3750 | 0.2958 | 0.4468 | 4.98e-06 | 5m9e:A, 5m9e:C, 5m9e:D |
| 3 | 2dq0:A | 447 | 49 | 0.2500 | 0.0313 | 0.2857 | 1.3 | 2dq0:B, 2zr2:A, 2zr2:B |
| 4 | 1qs0:A | 407 | 25 | 0.1786 | 0.0246 | 0.4000 | 1.4 | |
| 5 | 6k02:B | 269 | 35 | 0.1786 | 0.0372 | 0.2857 | 1.5 | 6k02:A |
| 6 | 1htw:A | 158 | 19 | 0.1964 | 0.0696 | 0.5789 | 1.7 | 1htw:B, 1htw:C |
| 7 | 1y7i:B | 262 | 32 | 0.1964 | 0.0420 | 0.3438 | 2.1 | 1xkl:A, 1xkl:B, 1xkl:C, 1xkl:D, 1y7i:A |
| 8 | 7myl:B | 158 | 24 | 0.1786 | 0.0633 | 0.4167 | 2.3 | 5ecc:A, 5ecc:B, 5ecx:A, 5ecx:B, 7myl:A, 7myl:C, 7myl:D, 7myl:E, 7myl:F, 7reg:A, 7reg:B, 7rgj:A, 7rgj:B |
| 9 | 4eot:A | 92 | 24 | 0.2321 | 0.1413 | 0.5417 | 3.5 | 4eot:B |
| 10 | 2wty:B | 97 | 24 | 0.2143 | 0.1237 | 0.5000 | 4.7 | 4auw:A, 4auw:B, 4auw:E, 4auw:F, 2wt7:B, 2wty:A |
| 11 | 3acw:A | 284 | 29 | 0.2321 | 0.0458 | 0.4483 | 4.9 | 3acx:A, 3acy:A, 3adz:A, 3ae0:A, 3ae0:B, 4e9u:A, 4e9z:A, 4ea0:A, 4ea0:B, 4ea1:A, 4ea2:A, 4f6v:A, 4f6x:A, 3lgz:B, 3npr:A, 3nri:A, 3tfn:A, 3tfp:A, 3tfv:A, 3vje:A, 3vje:B, 3w7f:A, 3w7f:B, 2zcq:A, 2zcr:A, 2zcs:A, 2zy1:A |
| 12 | 1a05:A | 357 | 44 | 0.2679 | 0.0420 | 0.3409 | 7.1 | 1a05:B |
umich.edu