AAAPGKNFDLSHWKLQLPDANTTEISSANLGLGYTSQYFYTDTDGAMTFWAPTTGGTTANSSYPRSELREMLDPSNSKVN
WGWQGTHTMKLSGKTVQLPSSGKIIVAQIHGIMDDGTNAPPLVKAVFQDGQLDMQVKQNSDGTGSDVHNYFTGIKLGDLY
NMEIRVTDGVAYVTMNGDTRSVDFVGKDAGWKNLKYYFKAGNFVQDNTSTGGSAIAKLYSLSVSHS
The query sequence (length=226) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2zaa:A | 232 | 226 | 0.9956 | 0.9698 | 0.9956 | 2.93e-168 | 2cws:A, 2zab:A, 2zac:A |
2 | 5xnr:A | 385 | 235 | 0.3009 | 0.1766 | 0.2894 | 3.30e-14 | 7d29:A, 7d2a:A |
3 | 7w12:A | 490 | 77 | 0.1327 | 0.0612 | 0.3896 | 1.74e-08 | |
4 | 7ncz:A | 227 | 232 | 0.2655 | 0.2643 | 0.2586 | 1.28e-05 | 7nm6:A, 7npp:A, 7ny3:A, 7o6h:A, 7oof:A, 7ory:A, 7p25:A, 7p90:A, 7pbf:A |
5 | 8pcx:A | 232 | 228 | 0.2743 | 0.2672 | 0.2719 | 0.001 | 8bjo:A, 8bxz:A, 8p6o:A, 8pc3:A, 8pc8:A, 8pdt:A, 8ped:A, 8qli:A, 8r43:A, 8rbn:A |
6 | 2q1w:A | 300 | 61 | 0.0796 | 0.0600 | 0.2951 | 1.6 | 2q1w:B, 2q1w:C |
7 | 4yo7:A | 287 | 89 | 0.0973 | 0.0767 | 0.2472 | 3.3 | |
8 | 3w15:A | 336 | 56 | 0.0575 | 0.0387 | 0.2321 | 3.8 | |
9 | 6oh9:A | 452 | 22 | 0.0487 | 0.0243 | 0.5000 | 5.0 | 6oha:A |
10 | 6ee7:A | 91 | 54 | 0.0531 | 0.1319 | 0.2222 | 6.7 | 1m1p:A, 1m1p:B, 1m1p:C, 1m1p:D, 1m1p:E, 1m1p:F, 1m1q:A, 1m1r:A |