AAAKELEESSFRKTFEDYLHNVVFVPSPSR
The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7md5:M | 30 | 30 | 1.0000 | 1.0000 | 1.0000 | 3.78e-16 | 7md5:N |
| 2 | 8guy:F | 835 | 27 | 0.8333 | 0.0299 | 0.9259 | 4.01e-12 | 6ce7:P, 6ce9:M, 6ce9:P, 6ceb:M, 6ceb:P, 8guy:E, 6hn5:E, 5j3h:E, 7kd6:E, 7kd6:K, 7kd6:Q, 7kd6:W, 5kqv:E, 5kqv:F, 7mqo:F, 7mqo:E, 7mqr:E, 7mqr:F, 4oga:E, 7pg0:B, 7pg2:B, 7pg3:B, 7pg4:B, 7qid:C, 7sl3:A, 7sl3:B, 6sof:A, 6sof:C, 7u6e:F, 7u6e:E, 6vep:E, 6vep:K, 6vep:Q, 6vep:W, 6veq:K, 6veq:E, 3w11:E, 3w12:E, 3w13:E, 4xss:E, 4xst:E, 7yq3:F, 7yq3:E, 7yq4:E, 7yq4:F, 7yq5:F |
| 3 | 7sl6:A | 819 | 27 | 0.8333 | 0.0305 | 0.9259 | 4.47e-12 | 7mqs:F, 7mqs:E, 7sl1:A, 7sl1:B, 7sl2:A, 7sl2:B, 7sl6:B, 7sl7:A, 7sl7:B |
| 4 | 6hn5:F | 323 | 25 | 0.8000 | 0.0743 | 0.9600 | 2.82e-11 | |
| 5 | 7sl4:A | 786 | 23 | 0.7667 | 0.0293 | 1.0000 | 2.37e-10 | 8dtm:B |
| 6 | 6jk8:A | 823 | 18 | 0.3667 | 0.0134 | 0.6111 | 8.05e-04 | 1igr:A, 7v3p:B |
| 7 | 6jk8:B | 801 | 16 | 0.2667 | 0.0100 | 0.5000 | 0.98 | |
| 8 | 6ycx:B | 817 | 16 | 0.2667 | 0.0098 | 0.5000 | 3.3 | 8a12:A, 8cdm:A, 8cdq:A, 6i7e:A, 6ycx:A, 6ycy:A, 6ycz:A |
| 9 | 8ijg:C | 250 | 24 | 0.3667 | 0.0440 | 0.4583 | 6.1 | 8ij6:A, 8ij6:B, 8ij6:C, 8ij6:D, 8ijg:A, 8ijg:B, 8ijg:D |
| 10 | 6iv9:A | 874 | 16 | 0.3000 | 0.0103 | 0.5625 | 8.3 | 6iv8:A, 6iv8:C |
| 11 | 4bjr:A | 500 | 26 | 0.3000 | 0.0180 | 0.3462 | 8.4 | 4b0t:A, 4b0t:B, 4bjr:B |
zhanggroup.org