Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

You can:

Check the GPCR table for details.
Go to the ligand list to see ligands that interacts with this GPCR.
Go to the individual ligand page for PubMed ID information by text mining.
Download a TSV version of all interaction data.
Go back to previous page.

GPCR

Name	Delta-type opioid receptor
Species	Mus musculus (Mouse)
Gene	Oprd1
Synonym	OP1 MSL-2 K56 DOR-1 DOR DOPr DOP Delta receptor D-OR-1 opioid receptor [ Show all ]
Disease	N/A for non-human GPCRs
Length	372
Amino acid sequence	MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTACTPSDGPGGGAAA
UniProt	P32300
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL3222
IUPHAR	317
DrugBank	N/A

Known ligands

You can:

Click GLASS IDs to check the association information.
Click ligand names to check details of the ligands.
Download a TSV version of all interaction information.
Download a SDF structure collection of all known ligands.

GLASS ID	Molecule	Formula	Molecular weight	H-bond acceptor / donor	XlogP	Lipinski's druglikeness
576	CHEMBL44172	C25H31N5O7	513.551	8 / 7	-3.4	No
592	Tyr-Pro-Emp-Phe-NH2	C35H43N5O5	613.759	6 / 5	3.8	No
695	CHEMBL76086	C31H41N5O7S2	659.817	10 / 7	-0.3	No
696	CHEMBL310681	C31H41N5O7S2	659.817	10 / 7	-0.3	No
703	CHEMBL80626	C31H41N5O7S2	659.817	10 / 7	-0.3	No
705	CHEMBL307614	C31H41N5O7S2	659.817	10 / 7	-0.3	No
1513	CHEMBL556537	C70H89F6N11O15	1438.53	22 / 14	5.8	No
1534	SB-0304	C25H29N5O5	479.537	6 / 4	-0.2	Yes
2415	CHEMBL595015	C22H28N4O	364.493	4 / 0	4.8	Yes
463230	CHEMBL3609619	C32H30F6N4O5	664.605	12 / 5	4.5	No
3172	CHEMBL557188	C60H72F6N10O9	1191.29	16 / 10	7.4	No
3357	CHEMBL317269	C23H31NO4	385.504	5 / 1	2.5	Yes
3527	CHEMBL38576	C21H24Cl2N2O	391.336	2 / 0	4.6	Yes
3570	CHEMBL231049	C24H31N3O2	393.531	3 / 1	2.7	Yes
4312	CHEMBL2371782	C24H30N4O5	454.527	6 / 5	0.4	Yes
4426	CHEMBL2147922	C25H24ClF3N2O2	476.924	7 / 3	N/A	N/A
4454	CHEMBL230943	C27H31N3O2	429.564	3 / 1	4.1	Yes
4483	CHEMBL2371935	C37H44N4O6	640.781	7 / 5	3.1	No
4640	CHEMBL593613	C21H26N4O	350.466	4 / 1	4.5	Yes
4912	(2E,4E)-N-isobutyltetradeca-2,4-dienamide	C18H33NO	279.468	1 / 1	6.6	No
463564	CHEMBL3613884	C27H34F3N3O3	505.582	8 / 2	N/A	No
5841	BDBM50321606	C80H98N18O14	1535.78	17 / 18	2.2	No
6004	CHEMBL1834895	C44H51N3O9	765.904	12 / 4	3.2	No
6009	CHEMBL1834901	C44H51N3O9	765.904	12 / 4	3.2	No
6349	CHEMBL2163917	C33H36N6O6	612.687	7 / 6	1.5	No
6395	CHEMBL385779	C34H48N6O5	620.795	8 / 7	2.5	No
6768	CHEMBL1270475	C27H28N2O2	412.533	4 / 2	4.1	Yes
7384	CHEMBL3215911	C35H39Cl2N3O4	636.614	6 / 5	N/A	No
7667	CHEMBL278889	C33H38N6O6	614.703	7 / 6	1.8	No
7756	CHEMBL610002	C47H48N2O7	752.908	9 / 4	4.2	No
8142	CHEMBL557243	C32H35N5O5	569.662	6 / 5	2.5	No
8358	CHEMBL315603	C32H50N8O10	706.798	11 / 10	-3.1	No
8666	CHEMBL437242	C46H73N15O9	980.186	12 / 14	-2.1	No
9369	CHEMBL60714	C29H30N2O3	454.57	4 / 3	4.0	Yes
9604	CHEMBL2163544	C26H29N3O4	447.535	6 / 4	0.5	Yes
9960	CHEMBL387670	C61H73F6N9O10	1206.3	17 / 8	8.1	No
10057	H-Tyr-D-Ala-Gly-Phe-Met-NH2	C28H38N6O6S	586.708	8 / 7	-0.1	No
10154	CHEMBL93131	C20H23BrN2O2	403.32	3 / 2	3.4	Yes
11322	Norbinaltorphimine	C40H43N3O6	661.799	8 / 5	3.2	No
11614	BDBM50098673	C25H24N2O3	400.478	4 / 3	3.7	Yes
11617	CHEMBL611697	C25H24N2O3	400.478	4 / 3	3.7	Yes
11668	CHEMBL272050	C20H25N3O2	339.439	4 / 0	3.7	Yes
11976	CHEMBL346165	C27H27N3O3	441.531	5 / 2	2.9	Yes
12084	CHEMBL1089542	C25H35N5O	421.589	3 / 2	2.7	Yes
12193	CHEMBL415795	C64H106N22O12	1375.69	17 / 19	-2.4	No
12199	CHEMBL262963	C64H106N22O12	1375.69	17 / 19	-2.4	No
12564	Piperidine, 1-[(2E,4E)-1-oxo-2,4-tetradecadienyl]-	C19H33NO	291.479	1 / 0	6.3	No
13263	CHEMBL1834903	C42H49N3O8	723.867	11 / 5	2.3	No
13264	CHEMBL1834902	C42H49N3O8	723.867	11 / 5	2.3	No
13379	CHEMBL606959	C34H35N3O6	581.669	8 / 5	1.7	No
13385	BDBM50018790	C34H35N3O6	581.669	8 / 5	1.7	No
13570	CHEMBL1834898	C46H55N3O9	793.958	12 / 4	4.3	No
13603	CHEMBL3264748	C31H34N2O5	514.622	6 / 1	3.9	No
521857	CHEMBL3823054	C33H51N9O5	653.829	8 / 9	0.4	No
14030	CHEMBL1766208	C61H74F6N10O9S	1237.37	17 / 10	7.3	No
14088	CHEMBL611925	C57H64F6N10O9S2	1211.31	18 / 10	6.0	No
14095	CHEMBL611924	C57H64F6N10O9S2	1211.31	18 / 10	6.0	No
14190	CHEMBL132164	C41H59N9O9	821.977	10 / 10	1.2	No
14390	CHEMBL307133	C29H39N5O5	537.661	7 / 5	2.2	No
14591	CHEMBL2402930	C32H43N9O6	649.753	8 / 8	-0.8	No
14802	CHEMBL3217021	C29H35Cl2N3O4	560.516	6 / 6	N/A	No
15356	CHEMBL2147917	C25H26N2O3	402.494	5 / 2	3.4	Yes
15706	CHEMBL2419124	C30H30ClN3O4	532.037	6 / 3	2.8	No
15798	CHEMBL61940	C22H24N2O3	364.445	4 / 3	2.4	Yes
15801	CHEMBL611129	C22H24N2O3	364.445	4 / 3	2.4	Yes
15844	CHEMBL134201	C27H26FNO4	447.506	6 / 2	4.1	Yes
16136	H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-O-Bzl	C52H62N8O9	943.115	10 / 8	5.0	No
16168	CHEMBL258704	C29H30N4O3S	514.644	6 / 3	4.1	No
16795	Pipamperone	C21H30FN3O2	375.488	5 / 1	2.0	Yes
521968	CHEMBL3808523	C77H106N24O13	1575.85	18 / 26	0.1	No
17437	BDBM50140910	C20H20N2O2	320.392	4 / 1	2.4	Yes
17445	CHEMBL611687	C20H20N2O2	320.392	4 / 1	2.4	Yes
17642	CHEMBL412324	C47H75N15O9	994.213	12 / 14	-0.5	No
17782	CHEMBL296782	C38H55N9O9	781.912	10 / 10	0.3	No
17974	CHEMBL405057	C60H98N22O12	1319.59	17 / 19	-4.1	No
17979	CHEMBL407084	C60H98N22O12	1319.59	17 / 19	-4.1	No
18009	CHEMBL294982	C30H40N6O8	612.684	9 / 8	-3.4	No
18310	CHEMBL2387739	C31H36ClN3O5	566.095	6 / 4	N/A	No
18329	CHEMBL2323575	C48H59N9O10	922.053	11 / 11	1.6	No
19005	CHEMBL520557	C29H30N2O3	454.57	4 / 2	3.6	Yes
19013	BDBM85541	C28H35NO4	449.591	5 / 2	3.6	Yes
19017	BDBM85540	C28H35NO4	449.591	5 / 2	3.6	Yes
19048	CHEMBL163769	C35H54N8O10	746.863	11 / 10	-2.1	No
19737	CHEMBL1076725	C69H84N10O9	1197.49	13 / 9	5.8	No
19788	UNII-5F4WO3BVS9	C16H29NO	251.414	1 / 1	5.5	No
19932	CHEMBL1213990	C47H61F2N9O12	982.053	15 / 12	-0.1	No
442448	CHEMBL3339376	C21H24N2O3	352.434	5 / 2	1.2	Yes
20046	CHEMBL2016674	C21H24N2O3	352.434	5 / 2	1.2	Yes
20394	CHEMBL610539	C38H43N3O5	621.778	6 / 2	4.3	No
20395	BDBM50044863	C38H43N3O5	621.778	6 / 2	4.3	No
20810	CHEMBL386990	C24H31N3O2	393.531	3 / 1	2.8	Yes
20852	CHEMBL274204	C29H39N5O8S	617.718	10 / 6	-2.3	No
20855	CHEMBL2315356	C25H30ClF3N2O5	530.969	9 / 4	N/A	No
21078	CHEMBL2371720	C35H43N5O5	613.759	6 / 5	3.7	No
21081	CHEMBL179246	C35H43N5O5	613.759	6 / 5	3.7	No
21206	CHEMBL2437062	C27H27N3O5	473.529	6 / 1	3.1	Yes
21374	CHEMBL2387214	C75H100N16O12	1417.72	15 / 15	2.9	No
21870	CHEMBL271077	C24H31FO8	466.502	9 / 0	2.8	Yes
21953	CHEMBL611703	C27H30N2O3	430.548	4 / 3	4.3	Yes
21959	BDBM50098676	C27H30N2O3	430.548	4 / 3	4.3	Yes

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417