You can:
Name | 5-hydroxytryptamine receptor 2C |
---|---|
Species | Homo sapiens (Human) |
Gene | HTR2C |
Synonym | Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C [ Show all ] |
Disease | Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse [ Show all ] |
Length | 458 |
Amino acid sequence | MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV |
UniProt | P28335 |
Protein Data Bank | 6bqg, 6bqh |
GPCR-HGmod model | P28335 |
3D structure model | This structure is from PDB ID 6bqg. |
BioLiP | BL0404805, BL0404806 |
Therapeutic Target Database | T83813 |
ChEMBL | CHEMBL225 |
IUPHAR | 8 |
DrugBank | BE0004957, BE0004881, BE0000533 |
Name | BW-723C86 |
---|---|
Molecular formula | C16H18N2OS |
IUPAC name | 1-[5-(thiophen-2-ylmethoxy)-1H-indol-3-yl]propan-2-amine |
Molecular weight | 286.393 |
Hydrogen bond acceptor | 3 |
Hydrogen bond donor | 2 |
XlogP | 3.0 |
Synonyms | alpha-methyl-5-(2-thienylmethoxy)-1H-indole-3-ethanamine CAS_5311036 Lopac0_000217 SCHEMBL3298862 BPBio1_000023 [ Show all ] |
Inchi Key | ALFGDCNSEBJYSP-UHFFFAOYSA-N |
Inchi ID | InChI=1S/C16H18N2OS/c1-11(17)7-12-9-18-16-5-4-13(8-15(12)16)19-10-14-3-2-6-20-14/h2-6,8-9,11,18H,7,10,17H2,1H3 |
PubChem CID | 4284720 |
ChEMBL | CHEMBL1255834 |
IUPHAR | 161 |
BindingDB | 82472 |
DrugBank | N/A |
Structure | ![]() |
Lipinski's druglikeness | This ligand satisfies Lipinski's rule of five. |
Parameter | Value | Reference | Database source |
---|---|---|---|
IC50 | 204.3 nM | DrugMatrix in vitro pharmacology data | ChEMBL |
Ki | 77.62 nM | PMID15322733 | BindingDB |
Ki | 79.4328 - 125.893 nM | PMID15322733, PMID12970106 | IUPHAR |
Ki | 93.33 nM | PMID10498829 | BindingDB |
Ki | 107.0 nM | DrugMatrix in vitro pharmacology data | ChEMBL |
Ki | 114.82 nM | PMID11882920 | BindingDB |
Ki | 316.23 nM | PMID7881740 | BindingDB |
Ki | 501.19 nM | PMID8730737, PMID8788493, PMID9144661 | BindingDB |
zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417