Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(3) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD3
Synonym	dopaminergic receptor D3 D3R D3 receptor dopamine D3 receptor
Disease	Unspecified Emesis; Gastric motility disorder Female sexual dysfunction Male sexual disorders Psychotic disorders Cocaine addiction Schizophrenia Drug abuse [ Show all ]
Length	400
Amino acid sequence	MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTVCSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
UniProt	P35462
Protein Data Bank	3pbl
GPCR-HGmod model	P35462
3D structure model	This structure is from PDB ID 3pbl.
BioLiP	BL0191566, BL0191567
Therapeutic Target Database	T02551
ChEMBL	CHEMBL234
IUPHAR	216
DrugBank	BE0000581

Ligand

Name	(+)-sulpiride
Molecular formula	C15H23N3O4S
IUPAC name	N-[[(2R)-1-ethylpyrrolidin-2-yl]methyl]-2-methoxy-5-sulfamoylbenzamide
Molecular weight	341.426
Hydrogen bond acceptor	6
Hydrogen bond donor	2
XlogP	0.6
Synonyms	Eglonyl (TN) Hoechst Brand of Sulpiride Levosulpiride [INN] NCGC00015966-01 Pontiride S 8010 (R)-(+)-5-aminosulfonyl-N-[(1-ethyl-2-pyrrolidinyl)methyl]-2-methoxybenzamide Sulpiride (JP15/USAN/INN) Sulpor BDBM81775 vertigo neogama D03QGM FT-0630504 KS-00000XKE Lopac-S-7771 Neuraxpharm (TN) R-(+)-sulpiride SCHEMBL15475031 (R)-sulpiride Sulpiride-high,(-) Allphar Brand of Sulpiride Tocris-0894 Bosnyl (TN) ZINC20229 Desitin Brand of Sulpiride Dogmatyl (TN) Hennig Brand of Sulpiride Levopraid Meresa (TN) PDSP2_001633 Rosemont Brand of Sulpiride Sulperide 4109R0VM5R Sulpiryd (TN) Arminol Uriach Brand of Sulpiride Ekilid Hormosan Brand of Sulpiride Levosulpiride-d3 NCGC00015966-02 Psicofarma Brand of Sulpiride Sanofi Synthelabo Brand of Sulpiride (R)-(+)-sulpiride Sulpiride, (+)- AC1LD7D1 Sulpride Benzamide, 5-(aminosulfonyl)-N-((1-ethyl-2-pyrrolidinyl)methyl)-2-methoxy-, (R)- Vertigo-Meresa Deponerton Fumouzer Brand of Sulpiride Lebopride Lopac-S-8010 PDSP1_000619 R. D. 1403 Spyfarma Brand of Sulpiride (RS)-( inverted exclamation markA)-Sulpiride Sulpiride-low,(-) Almirall Brand of Sulpiride UNII-4109R0VM5R Centrum Brand of Sulpiride Digton Dolorgiet Brand of Sulpiride Hexal Brand of Sulpiride Levosulpirida N-[[(2R)-1-ethylpyrrolidin-2-yl]methyl]-2-methoxy-5-sulfamoylbenzamide Pharmacia Brand of Sulpiride RV-12309 (inverted question mark)-Sulpiride Sulpirid (TN) Sulpivert B6492 Vertigo Meresa CHEMBL196677 Erempharma Brand of Sulpiride Krewel Brand of Sulpiride Levosulpiridum NCGC00024852-01 R(+)-SULPIRIDE Sanofi-Synthelabo Brand of Sulpiride (R)-(-)-N-[(1-Ethyl-2-pyrrolidinyl)methyl]-5-sulfamoyl-o-anisamide Sulpiride-d ACM124020275 Tepavil Benzamide, 5-(aminosulfonyl)-N-[[(2S)-1-ethyl-2-pyrrolidinyl]methyl]-2-methoxy- vertigo-neogama Desisulpid GTPL960 Levobren Magnetic resonance imaging sulpiride PDSP2_000617 Ratiopharm (TN) Sulp 23756-79-8 Sulpiride-R Areu Brand of Sulpiride UNII-7MNE9M8287 component BGRJTUBHPOOWDU-LLVKDONJSA-N CHEBI:64122 Dogmatil (TN) [ Show all ]
Inchi Key	BGRJTUBHPOOWDU-LLVKDONJSA-N
Inchi ID	InChI=1S/C15H23N3O4S/c1-3-18-8-4-5-11(18)10-17-15(19)13-9-12(23(16,20)21)6-7-14(13)22-2/h6-7,9,11H,3-5,8,10H2,1-2H3,(H,17,19)(H2,16,20,21)/t11-/m1/s1
PubChem CID	643497
ChEMBL	CHEMBL196677
IUPHAR	960
BindingDB	81775
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	7.99 nM	PMID8099194	IUPHAR

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417