Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Muscarinic acetylcholine receptor M5
Species	Homo sapiens (Human)
Gene	CHRM5
Synonym	M5R M5 receptor cholinergic receptor cholinergic receptor, muscarinic 5
Disease	Urinary incontinence Colitis Dysmenorrhea Irritable bowel syndrome Myasthenia gravis Neurological disease Schizophrenia Stomach ulcer Cognitive disorders Chronic obstructive pulmonary disease Allergic rhinitis Central and peripheral nervous diseases Brain diseases Amnesia [ Show all ]
Length	532
Amino acid sequence	MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
UniProt	P08912
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	T79961
ChEMBL	CHEMBL2035
IUPHAR	17
DrugBank	BE0000247, BE0004890

Ligand

Name	Desvenlafaxine
Molecular formula	C16H25NO2
IUPAC name	4-[2-(dimethylamino)-1-(1-hydroxycyclohexyl)ethyl]phenol
Molecular weight	263.381
Hydrogen bond acceptor	3
Hydrogen bond donor	2
XlogP	2.6
Synonyms	AK-72949 CHEBI:83527 DB06700 DVS 233 J10126 MolPort-003-846-411 O-Desmethylvenlafaxine 0.1 mg/ml in Methanol Phenol, 4-(2-(dimethylamino)-1-(1-hydroxycyclohexyl)ethyl)- 4-(2-(Dimethylamino)-1-(1-hydroxycyclohexyl)ethyl)phenol ST2410953 4CH-007182 AX8123273 CS-2818 Desvenlafaxine [INN:BAN] GTPL7158 Khedezla (TN) O-desmethyl venlafaxine O-Desmethylvenlafaxine, analytical standard (RS)-1-[2-(dimethylamino)-1-(4-hydroxyphenyl)ethyl]cyclohexanol s4113 4-[2-(Dimethylamino)-1-(1-hydroxycyclohexyl)ethyl]phenol # WY 45,233 A844583 AC1L2NUV BR-72949 D07793 dl-o-desmethylvenlafaxin HY-B0602 LS-178212 O-Desmethylvenlafaxine PDSP1_001804 1-[2-(dimethylamino)-1-(4-hydroxyphenyl)ethyl]cyclohexanol SCHEMBL34864 4-[2-dimethylamino-1-(1-hydroxycyclohexyl)ethyl]phenol X4688 AKOS015896311 EC 700-516-2 KB-33580 NCGC00345883-04 O-Desmethylvenlafaxine solution, 1.0 mg/mL in methanol, certified reference material Phenol, 4-[2-(dimethylamino)-1-(1-hydroxycyclohexyl)ethyl]- 4-[1-(1-hydroxycyclohexyl)-2-(dimethylamino)ethyl]phenol SW219514-2 AB0031560 BCP28517 CTK8E8385 desvenlafaxine(o-desnethylvenfaxine) HMS3652K16 KS-00000FZO o-desmethyl venlafaxine-d10 O-Desvenlafaxine (S)-Desmethyl Venlafaxine D6 SB17444 4-[2-(dimethylamino)-1-(1-oxidanylcyclohexyl)ethyl]phenol WY-45,233 ACMC-20ek0k CAS_386750-22-7 D0O3FG DS-1282 I06-2078 MLS006010042 O-DESMETHYLVENLAFAXINE (ODV) PDSP2_001787 1-[2-dimethylamino-1-(4-hydroxyphenyl)ethyl]cyclohexanol SMR004701214 413D628 AT-19352 CHEMBL1118 Desvenlafaxine (INN) FT-0654519 Khedezla NSC_6918664 O-Desmethylvenlafaxine solution, 100 mug/mL in methanol, ampule of 1 mL, certified reference material S-2830 4-[2-(Dimethylamino)-1-(1-hydroxycyclohexyl)ethyl]phenol TR-029259 93413-62-8 AB01563022_01 BDBM86748 d,l-O-Desmethylvenlafaxine Desvenlafaxine, 97% HSDB 7993 KYYIDSXMWOZKMP-UHFFFAOYSA-N O-desmethyl-venlafaxine ODV 1-[1-(4-hydroxyphenyl)-2-dimethylaminoethyl]cyclohexanol SC-82264 4-[2-Dimethyamino-1-(1-hydroxycyclohexyl)ethyl]phenol Wy-45233 [ Show all ]
Inchi Key	KYYIDSXMWOZKMP-UHFFFAOYSA-N
Inchi ID	InChI=1S/C16H25NO2/c1-17(2)12-15(13-6-8-14(18)9-7-13)16(19)10-4-3-5-11-16/h6-9,15,18-19H,3-5,10-12H2,1-2H3
PubChem CID	125017
ChEMBL	CHEMBL1118
IUPHAR	N/A
BindingDB	86748
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	<10000.0 nM	PMID16675639	BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417