Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Beta-2 adrenergic receptor
Species	Rattus norvegicus (Rat)
Gene	Adrb2
Synonym	beta2-adrenoceptor Beta-2 adrenoreceptor Beta-2 adrenoceptor beta-2 adrenergic receptor beta 2-AR B2AR adrenoceptor beta 2, surface adrenergic receptor ADRBR ADRB2R Adrb-2 Gpcr7 [ Show all ]
Disease	N/A for non-human GPCRs
Length	418
Amino acid sequence	MEPHGNDSDFLLAPNGSRAPGHDITQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKQAIDCYAKETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRSGHGLRSSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRANLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNGRTDYTGEQSAYQLGQEKENELLCEEAPGMEGFVNCQGTVPSLSIDSQGRNCNTNDSPL
UniProt	P10608
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL3754
IUPHAR	29
DrugBank	N/A

Ligand

Name	metoprolol
Molecular formula	C15H25NO3
IUPAC name	1-[4-(2-methoxyethyl)phenoxy]-3-(propan-2-ylamino)propan-2-ol
Molecular weight	267.369
Hydrogen bond acceptor	4
Hydrogen bond donor	2
XlogP	1.9
Synonyms	AC1L1HKM MCULE-7999715986 BDBM25756 Metoprololum Betaloc-Astra NCGC00021148-04 CCG-204813 Q-201400 CHEMBL13 dl-Metoprolol 1-(Isopropylamino)-3-(4-(2-methoxyethyl)phenoxy)propan-2-ol FT-0654603 1-[4-(2-methoxyethyl)phenoxy]-3-(propan-2-ylamino)-2-propanol H929 2-Propanol, 1-[4-(2-methoxyethyl)phenoxy]-3-[(1-methylethyl)amino]-, (.+/-.)- Jsp006606 A2878 Lopresoretic Spesicor Toprol-XL (TN) AN-41293 Beloc-Duriles Metrol (TN) BG-0006 Neobloc CGP-2175 Selo-Zok CTK7B2896 (+/-)-Metoprolol DTXSID2023309 1-(isopropylamino)-3-[4-(2-methoxyethyl)phenoxy]propan-2-ol H 93 26 1-[4-(2-methoxyethyl)phenoxy]-3-[(1-methylethyl)amino]-2-propanol HY-17503 37350-58-6 KS-000022ZD AB00053499-21 Lopressor ST2407314 {2-hydroxy-3-[4-(2-methoxyethyl)phenoxy]propyl}(propan-2-yl)amine Loresor BC214891 metoprolol tartarate Betaloc (TN) MolPort-005-938-039 C07202 Preblok CHEBI:6904 (RS)-Metoprolol EINECS 257-166-4 1-[(1-methylethyl)amino]-3-({4-[2-(methyloxy)ethyl]phenyl}oxy)propan-2-ol H 9326 2-Propanol, 1-(4-(2-methoxyethyl)phenoxy)-3-((1-methylethyl)amino)-, (+-)- I06-0125 54163-88-1 Lopresol (Salt/Mix) AB0013365 Seloken AstraZeneca Brand Toprol AKOS005927923 Meijoprolol Beatrolol Metoprololum [INN-Latin] BetalocAstra NCGC00021148-05 CCRIS 4198 SBI-0050706.P004 Corvitol (TN) DSSTox_CID_3309 1-(Isopropylamino)-3-(p-(2-methoxyethyl)phenoxy)-2-propanol GP-2175E 1-[4-(2-methoxyethyl)phenoxy]-3-(propan-2-ylamino)propan-2-ol HMS2090B15 KB-215767 A823609 Lopresoretic (Salt/Mix) Spesikor Tox21_303972 Lopressor (TN) AstraZeneca Brand of Metaoprolol Tartrate Metoprolol (USAN/INN) BelocDuriles Metroprolol BRD-A03623303-045-02-0 Neobloc (TN) CGP-2175C Selokeen (TN) D02358 (.+/-.)-Metoprolol Dutoprol 1-(Isopropylamino)-3-[p-(2-methoxyethyl)phenoxy]-2-propanol H 93-26 1-[4-(2-methoxyethyl)phenoxy]-3-[(propan-2-yl)amino]propan-2-ol I01-10535 4761AB L000669 AB00053499_22 STL301858 LS-122450 BCP09038 Metoprolol [USAN:INN:BAN] Betaloc Astra NCGC00021148-03 CAS-51384-51-1 Presolol DB00264 1-(4-(2-Methoxyethyl)-phenoxy)-3-((1-methylethyl)amino)-2-propanol FT-0602794 1-[4-(2-METHOXYETHYL)-PHENOXY]-3-[(1-METHYLETHYL)AMINO]-2-PROPANOL H-93/26 2-Propanol, 1-[4-(2-methoxyethyl)phenoxy]-3-[(1-methylethyl)amino]- IUBSYMUCCVWXPE-UHFFFAOYSA-N Lopresor AC-19022 Seroken TOPROL-XL AN-15262 Metohexal Beloc Duriles Metrol Betalok NCGC00356981-01 CGP 2175 SCHEMBL4093 CS-3159 (+/-)-1-(Isopropylamino)-3-(p-(beta-methoxyethyl)phenoxy)-2-propanol DSSTox_GSID_23309 1-(Isopropylamino)-3-[4-(2-methoxyethyl)phenoxy]-2-propanol GTPL553 1-[4-(2-methoxyethyl)phenoxy]-3-propan-2-ylamino-propan-2-ol HSDB 6531 3-[4-(2-methoxyethyl)phenoxy]-1-(propan-2-ylamino)propan-2-ol KB-55044 AB00053499 LOPRESSIDONE SR-01000003148-2 X-3755 Lopressor, Toprol-xl AstraZeneca Brand of Seloken Metoprolol succinate Betaloc Minax (TN) BRD-A03623303-045-05-3 Novartis Brand of Metprolol Tartrate CGP2175 D0I2MK (2R,3R)-2,3-dihydroxysuccinic acid;1-(isopropylamino)-3-[4-(2-methoxyethyl)phenoxy]propan-2-ol EINECS 253-483-7 1-Isopropylamino-3-[p-(2-methoxyethyl)phenoxy]-2-propanol H 93/26 (Salt/Mix) 2-Propanol, 1-(4-(2-methoxyethyl)phenoxy)-3-((1-methylethyl)amino)- I01-7125 51384-51-1 Leiras Brand of Metoprolol Succinate or Metoprolol Tartrate AB00053499_23 Seloken Tartrate, Metoprolol [ Show all ]
Inchi Key	IUBSYMUCCVWXPE-UHFFFAOYSA-N
Inchi ID	InChI=1S/C15H25NO3/c1-12(2)16-10-14(17)11-19-15-6-4-13(5-7-15)8-9-18-3/h4-7,12,14,16-17H,8-11H2,1-3H3
PubChem CID	4171
ChEMBL	CHEMBL13
IUPHAR	553
BindingDB	25756
DrugBank	DB00264
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	1698.24 nM	PMID1968985	BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417