Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Ligand

Name	23981-80-8
Molecular formula	C14H14O3
IUPAC name	2-(6-methoxynaphthalen-2-yl)propanoic acid
Molecular weight	230.263
Hydrogen bond acceptor	3
Hydrogen bond donor	1
XlogP	3.3
Synonyms	2-Naphthaleneacetic acid, 6-methoxy-.alpha.-methyl-, (S)- SC-78606 6-methoxy-alpha-methyl-2-naphthaleneacetic acid TL8001846 ACMC-209ftj AS-47598 CMWTZPSULFXXJA-UHFFFAOYSA-N H385 KS-00000H66 Mnpa (+/-)-6-Methoxy-alpha-methyl-2-naphthaleneacetic Acid NCGC00021127-05 2-(6-Methoxy-2-naphthyl)propionic acid Prestwick3_000045 rac-naproxen 26159-31-9 SMR001233475 AB0013024 AKOS000121315 BRD-A87719232-001-02-4 DB-007955 HMS3374N03 M-7686 (+)-alpha-(6-methoxy-2-naphthyl)propionic acid Naproxen (racemic) NCGC00094733-03 2-(6-Methoxy-naphthalen-2-yl)-propionic acid(Naproxen) 2-(6-Methoxynaphthalene-2-yl)propanoic acid S(+)-6-methoxy-alpha-methyl-2-naphthaleneacetic acid) 6-methoxy-2naphthyl-alpha-methylacetic acid STK301546 AC1L1B6B alpha-(6-Methoxy-2-naphthyl)propionic acid CHEBI:91939 EINECS 245-969-2 I14-106184 MLS002154184 (+/-)-2-(6-Methoxy-2-naphthyl)propionic Acid NCGC00021127-03 2-(6-Methoxy-2-naphthyl)propanoic acid Panoxen Proxine 2-naphthaleneacetic acid, 6-methoxy-alpha-methyl- SCHEMBL10029028 6-Methoxy-alpha-methyl-2-naphthaleneessigsaure TRA0033868 ACMC-209g7l BDBM50009860 CS-W009085 HMS2095I11 KS-00001PH5 MolPort-000-889-157 (RS)-2-(6-methoxynaphthalen-2-yl)propanoic acid NCGC00094733-01 2-(6-methoxy-2-naphtyl)propionic acid racemic 2-(6-methoxy-2-naphthyl)propionic acid 4CH-007732 ST024763 AB00513799 AKOS016038194 BSPBio_000169 DL Naproxen HMS3712I11 M1220 (+)2-(6-methoxy-2-naphthyl) propionic acid Naproxen2-(6-Methoxy-naphthalen-2-yl)-propionic acid 1264273-58-6 Niaxan 2-(6-methoxynaphth-2-yl)-propionic acid 2-Naphthaleneacetic acid, 6-methoxy-.alpha.-methyl-, (.alpha.S)- SBB029869 6-methoxy-alpha-methyl-2-naphthalenacetic acid TC-114024 AC1Q5RT0 ANW-25279 CHEMBL12952 FT-0638374 KB-163190 MLS006011863 (+/-)-6-METHOXY-ALPHA-METHYL-2-NAPHTHALENEACETIC A NCGC00021127-04 2-(6-Methoxy-2-naphthyl)propanoic acid, AldrichCPR Pranoxen Q-201030 SCHEMBL145769 6-methoxy-alpha-methyl-2-naphthylacetic acid [S(+)-2-(6-Methoxy-2-naphthyl)propionic acid] AK-40137 BPBio1_000187 CTK7A8174 HMS2230K21 LS-187192 (+)-(S)-6-Methoxy-a-methyl-2-naphthaleneacetic acid Naprosine (RS)-Naproxen NCGC00094733-02 2-(6-Methoxy-naphthalen-2-yl)-propionic acid Racemic Naproxen 6-methoxy-2-naphthyl-alpha-methylacetic acid ST24027595 AC-25684 ALBB-027257 CCG-220045 DL-Naproxen I06-0050 MCULE-6293512671 (+/-)-2-(6-methoxy-2-naphthyl) propionic acid NCGC00021127-02 2-(6-methoxy-2-naphthyl)-propionic acid Oprea1_018821 2-(6-methoxynaphthalen-2-yl)propanoic acid [ Show all ]
Inchi Key	CMWTZPSULFXXJA-UHFFFAOYSA-N
Inchi ID	InChI=1S/C14H14O3/c1-9(14(15)16)10-3-4-12-8-13(17-2)6-5-11(12)7-10/h3-9H,1-2H3,(H,15,16)
PubChem CID	1302
ChEMBL	N/A
IUPHAR	N/A
BindingDB	N/A
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	<10000.0 nM	http://pdsp.med.unc.edu/pdsp.php	PDSP

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417