Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 1E
Species	Homo sapiens (Human)
Gene	HTR1E
Synonym	5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled 5-HT1E_alpha 5-ht1e receptor 5-HT1E 5-HT-1E S31 Serotonin receptor 1E [ Show all ]
Disease	N/A
Length	365
Amino acid sequence	MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT
UniProt	P28566
Protein Data Bank	N/A
GPCR-HGmod model	P28566
3D structure model	This predicted structure model is from GPCR-EXP P28566.
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL2182
IUPHAR	4
DrugBank	BE0000476

Ligand

Name	oxymetazoline
Molecular formula	C16H24N2O
IUPAC name	6-tert-butyl-3-(4,5-dihydro-1H-imidazol-2-ylmethyl)-2,4-dimethylphenol
Molecular weight	260.381
Hydrogen bond acceptor	2
Hydrogen bond donor	2
XlogP	2.9
Synonyms	Spectrum3_000533 UNII-8VLN5B44ZY Rhinolitan FT-0082560 HMS2089G03 3-(4,5-dihydro-1H-imidazol-2-ylmethyl)-2,4-dimethyl-6-tert-butyl-phenol KBio2_006667 6-tert-butyl-3-(4,5-dihydro-1H-imidazol-2-ylmethyl)-2,4-dimethyl-phenol;hydrochloride MCULE-8690625159 AC-6370 NCGC00015766-03 Afrin Sinus 12 Hour Nasal Spray NCGC00015766-11 BPBio1_000295 Nezeril C07363 oxymeta zoline cid_66259 Oxymethazoline Dristan Long Lasting Nasal Mist Phenol, 6-tert-butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethyl- (7CI,8CI) SCHEMBL24301 Spectrum_001051 Vicks Sinex 12 Hour Ultra Fine Mist for Sinus Relief Prestwick0_000224 Genasal Nasal Spray Up to 12 Hour Relief Iliadin 6-t-Butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethylphenol KBioSS_001531 8VLN5B44ZY Nasivine (Salt/Mix) Afrin Cherry 12 Hour Nasal Spray NCGC00015766-06 AK113123 NCGC00022345-02 BRD-K16195444-003-16-1 Operil (TN) CC-33432 Oxymetazoline (INN) Phenol, 3-[(4,5-dihydro-1H-imidazol-2-yl)methyl]-6-(1,1-dimethylethyl)-2,4-dimethyl- DSSTox_GSID_40691 SPBio_002188 Tox21_110217 WYWIFABBXFUGLM-UHFFFAOYSA-N Prestwick3_000224 H-990 1491-59-4 KBio2_001531 6-tert-Butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethylphenol Lopac0_000903 AB00053513_14 NCGC00015766-01 Afrin Original 12 Hour Nose Drops NCGC00015766-09 BDBM30712 NCGC00022345-06 BSPBio_002145 Oximetazolinum Oxymetazolinum DivK1c_000567 Phenol, 6-t-butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethyl- Duramist Plus Up To 12 Hour Nasal Decongestant Spray Spectrum4_000464 Vicks Sinex SBI-0050878.P004 FT-0601532 HSDB 3143 3-[(4,5-Dihydro-1H-imidazol-2-yl)methyl]-6-(1,1-dimethylethyl)-2,4-dimethylphenol KBio3_001645 6-tert-Butyl-3-(4,5-dihydro-1H-imidazol-2-ylmethyl)-2,4-dimethylphenol Nafrine AC1L1IM1 NCGC00015766-04 Afrin, Dristan12-hrnasalspray, Ocuclear, Drixine NCGC00015766-13 BPBio1_000419 NINDS_000567 CAS-1491-59-4 oxymetazolina D08322 Oxymetozoline Drixoral Nasal Solution Phenol, 6-tert-butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethyl-(7CI,8CI) Sinerol STK075254 Visine L.R Prestwick1_000224 GTPL124 KB-302508 6-tert-butyl-3-((4,5-dihydro-1H-imidazol-2-yl)methyl)-2,4-dimethylphenol L000459 AB00053513-12 Navasin Afrin Extra Moisturizing 12 Hour Nasal Spray NCGC00015766-07 AKOS007930348 NCGC00022345-04 BRN 0886303 Oximetazolina CCG-204985 oxymetazoline hydrochloride crystalline DB00935 Phenol, 3-[(4,5-dihydro-1H-imidazol-2-yl)methyl]-6-(1,1-dimethylethyl)-2,4-dimethyl- (9CI) DSSTox_RID_79545 Spectrum2_000998 Tox21_110217_1 ZINC57435 Rhinofrenol EINECS 216-079-1 Hazol 2-(4-tert-Butyl-2,6-dimethyl-3-hydroxybenzyl)-2-imidazoline KBio2_004099 6-tert-Butyl-3-(4,5-dihydro-1H-imidazol-2-ylmethyl)-2,4-dimethyl-phenol LS-104146 AB00053513_15 NCGC00015766-02 Afrin Original 12 Hour Pump Mist NCGC00015766-10 Biomol-NT_000161 Neo-Synephrine 12 Hour Spray C-16261 Oxylazine CHEMBL762 Oxymetazolinum [INN-Latin] Dristan Long Lasting Mentholated Nasal Spray Phenol, 6-tert-butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethyl- SCH-9384 Spectrum5_001114 Vicks Sinex 12 Hour Nasal Spray FT-0650596 IDI1_000567 KBioGR_000908 6-tert-Butyl-3-(4,5-dihydro-1H-imidazol-2-ylmethyl)-2,4-dimethylphenol # Nasal Relief 12 Hour Nasal Spray Afrin NCGC00015766-05 AJ-09693 NCGC00015766-16 BRD-K16195444-001-01-7 Nostrilla 12 Hour Nasal Decongestant CAS-151615 D09EBS Phenol, 3-((4,5-dihydro-1H-imidazol-2-yl)methyl)-6-(1,1-dimethylethyl)-2,4-dimethyl- DSSTox_CID_20691 Phenol,3-[(4,5-dihydro-1H-imidazol-2-yl)methyl]-6-(1,1-dimethylethyl)-2,4-dimethyl- SPBio_001095 Tocris-1142 Visine L.R. Prestwick2_000224 H 990 KBio1_000567 6-tert-butyl-3-(2-imidazolin-2-ylmethyl)-2,4-dimethyl-phenol;hydrochloride Lopac-O-2378 AB00053513-13 Navisin Afrin Original 12 Hour Nasal Spray NCGC00015766-08 AN-10265 NCGC00022345-05 BSPBio_000267 Oximetazolina [INN-Spanish] CHEBI:7862 Oxymetazoline [INN:BAN] Decongestant (TN) Phenol, 3-[(4,5-dihydro-1H-imidazol-2-yl)methyl]-6-(1,1-dimethylethyl)-2,4-dimethyl-(9CI) DTXSID3040691 [ Show all ]
Inchi Key	WYWIFABBXFUGLM-UHFFFAOYSA-N
Inchi ID	InChI=1S/C16H24N2O/c1-10-8-13(16(3,4)5)15(19)11(2)12(10)9-14-17-6-7-18-14/h8,19H,6-7,9H2,1-5H3,(H,17,18)
PubChem CID	4636
ChEMBL	CHEMBL762
IUPHAR	124
BindingDB	30712
DrugBank	DB00935
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
EC50	99.0 nM	N/A	BindingDB
Ki	416.86 nM	PMID7984267	PDSP,BindingDB
Ki	419.0 nM	PMID1513320	PDSP,BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417