Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Apelin receptor
Species	Homo sapiens (Human)
Gene	APLNR
Synonym	msr/apj GPCR34 G-protein coupled receptor HG11 G-protein coupled receptor APJ AGTRL1 angiotensin II receptor-like 1 angiotensin receptor-like 1 APJR APJ apelin receptor B78 [ Show all ]
Disease	N/A
Length	380
Amino acid sequence	MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD
UniProt	P35414
Protein Data Bank	5vbl
GPCR-HGmod model	P35414
3D structure model	This structure is from PDB ID 5vbl.
BioLiP	BL0380094, BL0380093
Therapeutic Target Database	N/A
ChEMBL	CHEMBL1628481
IUPHAR	36
DrugBank	N/A

Ligand

Name	sphingosine
Molecular formula	C18H37NO2
IUPAC name	(E,2S,3R)-2-aminooctadec-4-ene-1,3-diol
Molecular weight	299.499
Hydrogen bond acceptor	3
Hydrogen bond donor	3
XlogP	5.3
Synonyms	DB03203 (4E)-Sphingenine erythro-C18-Sphingosine 2-amino-4-octadecene-1,3-diol HMS1989M08 4-Octadecene-1,3-diol, 2-amino-, (E)-dl-erythro- Lopac0_001049 4-trans-Sphingenine NCGC00024697-03 BDBM83205 SCHEMBL19398 BSPBio_001526 CHEBI:16393 SR-01000597656-1 D-erythro-C18-Sphingosine D-erythrosphingosine (2S,3R)-Sphingosine (2S,3R,4E)-2-Amino-4-octadecene-1,3-diol E66DE871-3B37-406A-891B-A804BDC7ABF9 (E,2S,3R)-2-amino-4-octadecene-1,3-diol Erythrosphingosine 2S-Amino-4E-octadecene-1,3R-diol HMS3650M05 4-Octadecene-1,3-diol, 2-amino-, (R-(R,S-(E))) MLS001332469 AC-28329 NCGC00024697-06 BMK1-D10 Sph(d18:1) c18-erythro-sphingenine Sphingosine 2S, 3R CHEMBL67166 UNII-0Y6SVQ612Q component WWUZIQQURGPMPG-KRWOKUGFSA-N D-erythro-Sphingosine (Egg, Chicken) (-)-D-erythro-Sphingosine D-Sphingosine, >=98.0% (TLC) D0L0YG (2S,3R,E)-2-aminooctadec-4-ene-1,3-diol EINECS 204-651-3 123-78-4 HMS1361M08 4-Octadecene-1,3-diol, 2-amino-, (2S,3R,4E)- (9CI) J-004983 4-Octadecene-1,3-diol,2-amino-, (2S,3R,4E)- MolPort-003-850-275 B6385 S0874 Brain Sphingosine Sphingoid CCRIS 6899 SQS D-(+)-erytho-4-trans-Sphingenine D-erythro-Sphingosine, Free Base, High Purity (2S,3R)-2-Amino-4-octadecene-1,3-diol ZINC8195650 (2S,3R,4E)-2-amino-1,3-octadec-4-enediol DErySphingosine (E)-2-Amino-4-octadecan-1,3-diol Erythro-dl-sphingosine 2-Aminooctadec-4-ene-1,3-diol HMS2232M04 4-Octadecene-1,3-diol, 2-amino-, (R,S-(E))- MFCD00036751 475662-41-0 NCGC00024697-04 BiomolKI2_000042 SMR000857107 C00319 Sphingosine (d18:1) CHEBI:26743 trans-4-Sphingenine D-erythro-Sphingosine D-Sphingosine (2S,3R,4E)-2-aminooctadec-4-ene-1,3-diol Egg Sphingosine (E,2S,3R)-2-aminooctadec-4-ene-1,3-diol EX-A1428 4-Octadecene-1,3-diol, 2-amino-, (2R,3S,4E)-rel- HY-101047 4-Octadecene-1,3-diol, 2-amino-, (R-(R,S-(E)))- MLS001332470 AC1NQWWW NCGC00024697-07 BML3-C09 Sphing-4-enine C18-Sphingosine Sphingosine d18:1 cid_5280335 UNII-NGZ37HRE42 D-erythro-Sphingosine (synthetic) (-)-Sphingosine D-Sphingosine, from bovine brain, ~99% (TLC) d18:1 D-erythro-sphingosine (4E)-sphing-4-enine erythro-4-Sphingenine 1711AH HMS1791M08 4-Octadecene-1,3-diol, 2-amino-, (E)-D-erythro- (8CI) LMSP01010001 4-Sphingenine NCGC00024697-02 BCP24874 SCHEMBL1471985 Brain Sphingosine, D-erythro-Sphingosine (Brain, Porcine), powder sphingosin cerebroside SR-01000597656 D-(+)-erythro-1,3-dihydroxy-2-amino-4-trans-octadecene D-Erythro-spinghosine (2S,3R)-2-aminooctadec-4-ene-1,3-diol (2S,3R,4E)-2-amino-3-hydroxyoctadec-4-ene-1-ol dl-Erythro-sphingosine (E)-D-erythro-4-octadecene-1,3-diol Erythro-sphingosine, (+)- 2733-29-1 HMS3402M08 4-Octadecene-1,3-diol, 2-amino-, (R,S-(E))-(+)- MLS-0412588.0001 NCGC00024697-05 BiomolKI_000034 SPH C18 sphingosine Sphingosine (d18:1), D-erythro-sphingosine, powder trans-D-erythro-2-Amino-4-octadecene-1,3-diol D-erythro-Sphingosine (Brain, Porcine) D-Sphingosine synthetic D-Sphingosine, synthetic (2S,3R,E)-2-Amino-4-octadecene-1,3-diol EI-155 (E,2S,3R)-2-azanyloctadec-4-ene-1,3-diol GTPL2452 4-octadecene-1,3-diol, 2-amino-, (2S,3R,4E)- IDI1_033996 4-Octadecene-1,3-diol, 2-amino-, [R-[R,S-(E)]]- MLS002172450 AKOS024458590 NGZ37HRE42 bmse000850 Sphingenine CCG-100638 Sphingosine with C18 chain CS-0020759 WWUZIQQURGPMPG-KRWOKUGFSA-N D-erythro-Sphingosine, 99+%, synthetical (2S,3R)-(E)-2-amino-1,3-dihydroxy-4-octadecene [ Show all ]
Inchi Key	WWUZIQQURGPMPG-KRWOKUGFSA-N
Inchi ID	InChI=1S/C18H37NO2/c1-2-3-4-5-6-7-8-9-10-11-12-13-14-15-18(21)17(19)16-20/h14-15,17-18,20-21H,2-13,16,19H2,1H3/b15-14+/t17-,18+/m0/s1
PubChem CID	5280335
ChEMBL	CHEMBL67166
IUPHAR	N/A
BindingDB	83205
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand has a partition coefficient log P greater than 5.

Experimental Data

Parameter	Value	Reference	Database source
IC50	<66600.0 nM	, PubChem BioAssay data set	BindingDB,ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417