Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Alpha-2A adrenergic receptor
Species	Mus musculus (Mouse)
Gene	Adra2a
Synonym	alpha2D alpha2A-AR alpha2A-adrenoceptor alpha2A-adrenergic receptor alpha2A Alpha-2AAR Alpha-2A adrenoreceptor Alpha-2A adrenoceptor adrenergic receptor Adrenergic alpha 2A receptor ADRA2R ADRA2 Adra-2a Adra-2 [ Show all ]
Disease	N/A for non-human GPCRs
Length	450
Amino acid sequence	MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGGQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACSAPPGGADRRPNGLGPERGAGPTGAEAEPLPTQLNGAPGEPAPAGPRDGDALDLEESSSSEHAERPPGPRRPDRGPRAKGKTRASQVKPGDSLPRRGPGAAGPGASGSGHGEERGGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPSQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
UniProt	Q01338
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL4075
IUPHAR	N/A
DrugBank	N/A

Ligand

Name	naphthalene
Molecular formula	C10H8
IUPAC name	naphthalene
Molecular weight	128.174
Hydrogen bond acceptor	0
Hydrogen bond donor	0
XlogP	3.3
Synonyms	napthalene EINECS 202-049-5 NCI-C52904 KB-57607 S652 Mighty RD1 Tox21_300008 N0004 White tar naphtaline Naphthalene solution, 100 ng/muL in cyclohexane, analytical standard Naphthalene, certified reference material, TraceCERT(R) AJ-24528 Naphthalene, molten [UN2304] [Flammable solid] BIDD:ER0665 NAPHTHALENE- D8 CHEMBL16293 NCGC00090793-03 FT-0651884 NSC-37565 LS-1917 SR-01000854997-2 Moth balls UN 2304 Naftalen [Polish] ZINC967522 Naphthalene [BSI:ISO] 91-20-3 Naphthalene, crude or refined [UN1334] [Flammable solid] AN-42549 Naphthalene, pure CAS-91-20-3 naphthalinr DSSTox_CID_913 DTXSID8020913 NCGC00254058-01 I14-6944 RCRA waste number U165 MFCD00001742 Tox21_111023 mothballr UNII-0TNN3Q0D4D component UFWIBTONFRDIAS-UHFFFAOYSA-N naphtalene Naphthalene 10 microg/mL in Cyclohexane Naphthalene, 99+%, scintillation grade ACMC-209r8h Naphthalene, for synthesis, 98.5% BDBM50159249 Naphthalene, United States Pharmacopeia (USP) Reference Standard CHEBI:16482 Naphthene NCGC00090793-01 EPA Pesticide Chemical Code 055801 NPY KS-00000VGR SMR000677944 MLS001055498 UFWIBTONFRDIAS-UHFFFAOYSA-N N0885 WLN: L66J Naphtalinum Naphthalene solution, certified reference material, 200 mug/mL in methanol 68412-25-9 Naphthalene, crude AKOS000119977 Naphthalene, molten [UN2304] [Flammable solid] C00829 Naphthalin Dezodorator DSSTox_GSID_20913 NCGC00090793-04 HMS3039N15 NSC37565 MCULE-8231589350 STL282720 moth flaker UN1334 naftaleno Naphthalene (molten) Naphthalene, 98% AB1003134 Naphthalene, crude or refined [UN1334] [Flammable solid] antimitr Naphthalene, SAJ first grade, >=98.0% Caswell No. 587 Naphthalinum EC 202-049-5 NCGC00259553-01 InChI=1/C10H8/c1-2-6-10-8-4-3-7-9(10)5-1/h1-8 RTR-003288 Mighty 150 Tox21_202004 Mothballs UNII-2166IN72UN Naphtalene [ISO:French] Naphthalene 100 microg/mL in Acetonitrile 2166IN72UN Naphthalene, analytical standard AI3-00278 Naphthalene, molten Bicyclo[4.4.0]deca-1,3,5,7,9-pentene Naphthalene,(S) Naphthyl Group NCGC00090793-02 F0001-2217 NSC 37565 L001166 SR-01000854997 MolPort-001-738-535 UN 1334 Naftalen ZB015456 naphthalen Naphthalene solution, certified reference material, 5000 mug/mL in methanol 72931-45-4 Naphthalene, crude or refined Albocarbon Naphthalene, Pharmaceutical Secondary Standard; Certified Reference Material Camphor tar Naphthaline Di(C5-C6)alkylnaphthalene DSSTox_RID_75860 NCGC00090793-05 HSDB 184 RCRA waste no. U165 Melting point standard 79-81C, analytical standard Tar camphor Moth flakes UN2304 naftalina Naphthalene 10 microg/mL in Acetonitrile Naphthalene, 99% AC1L1ACK Naphthalene, di-C5-6-alkyl derivs. ANW-39567 Naphthalene, suitable for scintillation, >=99% CCRIS 1838 naphthalir [ Show all ]
Inchi Key	UFWIBTONFRDIAS-UHFFFAOYSA-N
Inchi ID	InChI=1S/C10H8/c1-2-6-10-8-4-3-7-9(10)5-1/h1-8H
PubChem CID	931
ChEMBL	CHEMBL16293
IUPHAR	N/A
BindingDB	50159249
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	7.76 nM	PMID9605427	BindingDB
Ki	9.33 nM	PMID9605427	BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417