Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Cannabinoid receptor 2
Species	Homo sapiens (Human)
Gene	CNR2
Synonym	Peripheral cannabinoid receptor rCB2 hCB2 cannabinoid receptor 2 (macrophage) cannabinoid receptor 2 (spleen) CB-2 CB2 CB2 receptor CB2-R CX5 [ Show all ]
Disease	Immune disorder Inflammatory bowel disease Inflammatory disease Neuropathic pain Osteoporosis Pain Atopic dermatitis Rheumatoid arthritis [ Show all ]
Length	360
Amino acid sequence	MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
UniProt	P34972
Protein Data Bank	5zty
GPCR-HGmod model	P34972
3D structure model	This structure is from PDB ID 5zty.
BioLiP	BL0438927
Therapeutic Target Database	T37693
ChEMBL	CHEMBL253
IUPHAR	57
DrugBank	BE0000095

Ligand

Name	memantine
Molecular formula	C12H21N
IUPAC name	3,5-dimethyladamantan-1-amine
Molecular weight	179.307
Hydrogen bond acceptor	1
Hydrogen bond donor	1
XlogP	3.3
Synonyms	EU-0053634 KBio1_000068 1,3-Dimethyl-5-aminoadamantane Lopac0_000861 3,5-Dimethyl-1-aminoadamantane Memantine (extended release), Forest 51052-62-1 NCGC00015705-03 AKOS015953276 Oprea1_480562 BBL000737 SC-45525 BUGYDGFZZOZRHP-UHFFFAOYSA-N Spectrum5_001355 D 145 Tricyclo(3.3.1.13,7)decan-1-amine, 3,5-dimethyl- DMAA [Antiparkinson Agent] FT-0649142 KBio2_006223 1-amino-3,5-dimethyladamantan Memantin 3,5-dimethyladamantan-1-amine Memantine [INN:BAN] AB00053600_14 NCGC00015705-07 alzantin Prestwick2_000978 Biomol-NT_000209 SPBio_001456 CBMicro_020348 STK520682 D08174 W8O17SJF3T DSSTox_CID_25174 DTXSID5045174 HSDB 7327 KBioSS_001087 3,5-Dimethyl-1-adamantanamine 3,5-dimethyltricyclo[3.3.1.1~3,7~]decan-1-amine Memantinum [INN-Latin] AC1L1HB7 NCGC00024782-03 BB 0216388 SBB002574 BR-33967 Spectrum3_000923 CHEMBL807 Tox21_110199_1 DB01043 Exiba (TN) KBio2_001087 1-amino-3,5-dimethyl adamantane LS-157051 3,5-Dimethyl-1-aminoadamantane hydrochlo Memantine (INN) AB00053600 NCGC00015705-04 AKOS016340748 Prestwick0_000978 BBV-39899297 SCHEMBL13213676 C13736 Spectrum_000607 D-145 Tricyclo[3.3.1.13,7]decan-1-amine, 3,5-dimethyl- DRG 0267 GTPL4253 (3,5-Dimethyl-1-adamantyl)amine KBio3_001926 1-Amino-3,5-dimethyladamantane Memantina 3,5-dimethyladamantanylamine Memantine [INN] AB00053600_15 NCGC00015705-09 ANW-56451 Prestwick3_000978 BPBio1_001117 SPBio_002926 CCG-204092 TC-145196 D145 ZERO/006024 DSSTox_GSID_45174 Ebixa IDI1_000068 1,3-Dimethyl-5-adamantanamine KS-000024QT 3,5-Dimethyl-1-adamantylamine Memantine (extended release) 41100-52-1 (Hydrochloride) MolPort-002-041-858 AKOS000113995 NINDS_000068 BB0216388 SBI-0020417.P004 BSPBio_001015 Spectrum4_001022 CTK6B3298 Tricyclo(3.3.1.1(3,7))decan-1-amine, 3,5-dimethyl- DivK1c_000068 FCH1198345 KBio2_003655 1-amino-3,5-dimethyl-adamantane MCULE-3726352671 3,5-Dimethyl-adamantan-1-ylamine Memantine ER AB00053600-13 NCGC00015705-05 ALBB-013872 Prestwick1_000978 BDBM50062599 SCHEMBL2688 CAS-19982-08-2 ST057652 D01JEU UNII-W8O17SJF3T DS-3152 HMS500D10 (3,5-Dimethyl-1-adamantyl)amine hydrochloride KBioGR_001543 19982-08-2 Memantina [INN-Spanish] 3,5-Dimethyltricyclo(3.3.1.1(3,7))decan-1-amine Memantinum AB0212255 NCGC00024782-02 AZ0001-0553 S-1686 BPBio1_001270 Spectrum2_001408 CHEBI:64312 Tox21_110199 ZX-AN012621 DSSTox_RID_80723 [ Show all ]
Inchi Key	BUGYDGFZZOZRHP-UHFFFAOYSA-N
Inchi ID	InChI=1S/C12H21N/c1-10-3-9-4-11(2,6-10)8-12(13,5-9)7-10/h9H,3-8,13H2,1-2H3
PubChem CID	4054
ChEMBL	N/A
IUPHAR	N/A
BindingDB	N/A
DrugBank	DB01043
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	<10000.0 nM	http://pdsp.med.unc.edu/pdsp.php	PDSP

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417