Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 2C
Species	Homo sapiens (Human)
Gene	HTR2C
Synonym	Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C 5-HT2C receptor 5-HTR2C 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled 5-hydroxytryptamine receptor 1C HTR1C 5-HT-1C [ Show all ]
Disease	Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse Generalized anxiety disorder; Major depressive disorder Major depressive disorder Metabolic disorders Psychotic disorders Mood disorder Neurological disease Obesity Obesity; Diabetes Migraine headaches Anxiety disorder Alcohol use disorders Aggressive non-hodgkin's lymphoma [ Show all ]
Length	458
Amino acid sequence	MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
UniProt	P28335
Protein Data Bank	6bqg, 6bqh
GPCR-HGmod model	P28335
3D structure model	This structure is from PDB ID 6bqg.
BioLiP	BL0404805, BL0404806
Therapeutic Target Database	T83813
ChEMBL	CHEMBL225
IUPHAR	8
DrugBank	BE0004957, BE0004881, BE0000533

Ligand

Name	memantine
Molecular formula	C12H21N
IUPAC name	3,5-dimethyladamantan-1-amine
Molecular weight	179.307
Hydrogen bond acceptor	1
Hydrogen bond donor	1
XlogP	3.3
Synonyms	SPBio_001456 CBMicro_020348 STK520682 D08174 W8O17SJF3T DSSTox_CID_25174 FT-0649142 KBio2_006223 1-amino-3,5-dimethyladamantan Memantin 3,5-dimethyladamantan-1-amine Memantine [INN:BAN] AB00053600_14 NCGC00015705-07 alzantin Prestwick2_000978 Biomol-NT_000209 BR-33967 Spectrum3_000923 CHEMBL807 Tox21_110199_1 DB01043 DTXSID5045174 HSDB 7327 KBioSS_001087 3,5-Dimethyl-1-adamantanamine 3,5-dimethyltricyclo[3.3.1.1~3,7~]decan-1-amine Memantinum [INN-Latin] AC1L1HB7 NCGC00024782-03 BB 0216388 SBB002574 SCHEMBL13213676 C13736 Spectrum_000607 D-145 Tricyclo[3.3.1.13,7]decan-1-amine, 3,5-dimethyl- DRG 0267 Exiba (TN) KBio2_001087 1-amino-3,5-dimethyl adamantane LS-157051 3,5-Dimethyl-1-aminoadamantane hydrochlo Memantine (INN) AB00053600 NCGC00015705-04 AKOS016340748 Prestwick0_000978 BBV-39899297 BPBio1_001117 SPBio_002926 CCG-204092 TC-145196 D145 ZERO/006024 DSSTox_GSID_45174 GTPL4253 (3,5-Dimethyl-1-adamantyl)amine KBio3_001926 1-Amino-3,5-dimethyladamantane Memantina 3,5-dimethyladamantanylamine Memantine [INN] AB00053600_15 NCGC00015705-09 ANW-56451 Prestwick3_000978 BSPBio_001015 Spectrum4_001022 CTK6B3298 Tricyclo(3.3.1.1(3,7))decan-1-amine, 3,5-dimethyl- DivK1c_000068 Ebixa IDI1_000068 1,3-Dimethyl-5-adamantanamine KS-000024QT 3,5-Dimethyl-1-adamantylamine Memantine (extended release) 41100-52-1 (Hydrochloride) MolPort-002-041-858 AKOS000113995 NINDS_000068 BB0216388 SBI-0020417.P004 SCHEMBL2688 CAS-19982-08-2 ST057652 D01JEU UNII-W8O17SJF3T DS-3152 FCH1198345 KBio2_003655 1-amino-3,5-dimethyl-adamantane MCULE-3726352671 3,5-Dimethyl-adamantan-1-ylamine Memantine ER AB00053600-13 NCGC00015705-05 ALBB-013872 Prestwick1_000978 BDBM50062599 BPBio1_001270 Spectrum2_001408 CHEBI:64312 Tox21_110199 ZX-AN012621 DSSTox_RID_80723 HMS500D10 (3,5-Dimethyl-1-adamantyl)amine hydrochloride KBioGR_001543 19982-08-2 Memantina [INN-Spanish] 3,5-Dimethyltricyclo(3.3.1.1(3,7))decan-1-amine Memantinum AB0212255 NCGC00024782-02 AZ0001-0553 S-1686 SC-45525 BUGYDGFZZOZRHP-UHFFFAOYSA-N Spectrum5_001355 D 145 Tricyclo(3.3.1.13,7)decan-1-amine, 3,5-dimethyl- DMAA [Antiparkinson Agent] EU-0053634 KBio1_000068 1,3-Dimethyl-5-aminoadamantane Lopac0_000861 3,5-Dimethyl-1-aminoadamantane Memantine (extended release), Forest 51052-62-1 NCGC00015705-03 AKOS015953276 Oprea1_480562 BBL000737 [ Show all ]
Inchi Key	BUGYDGFZZOZRHP-UHFFFAOYSA-N
Inchi ID	InChI=1S/C12H21N/c1-10-3-9-4-11(2,6-10)8-12(13,5-9)7-10/h9H,3-8,13H2,1-2H3
PubChem CID	4054
ChEMBL	N/A
IUPHAR	N/A
BindingDB	N/A
DrugBank	DB01043
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	<10000.0 nM	http://pdsp.med.unc.edu/pdsp.php	PDSP

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417