Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Alpha-2A adrenergic receptor
Species	Mus musculus (Mouse)
Gene	Adra2a
Synonym	alpha2D alpha2A-AR alpha2A-adrenoceptor alpha2A-adrenergic receptor alpha2A Alpha-2AAR Alpha-2A adrenoreceptor Alpha-2A adrenoceptor adrenergic receptor Adrenergic alpha 2A receptor ADRA2R ADRA2 Adra-2a Adra-2 [ Show all ]
Disease	N/A for non-human GPCRs
Length	450
Amino acid sequence	MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGGQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACSAPPGGADRRPNGLGPERGAGPTGAEAEPLPTQLNGAPGEPAPAGPRDGDALDLEESSSSEHAERPPGPRRPDRGPRAKGKTRASQVKPGDSLPRRGPGAAGPGASGSGHGEERGGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPSQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
UniProt	Q01338
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL4075
IUPHAR	N/A
DrugBank	N/A

Ligand

Name	Yohimbine
Molecular formula	C21H26N2O3
IUPAC name	methyl (1S,15R,18S,19R,20S)-18-hydroxy-1,3,11,12,14,15,16,17,18,19,20,21-dodecahydroyohimban-19-carboxylate
Molecular weight	354.45
Hydrogen bond acceptor	4
Hydrogen bond donor	2
XlogP	2.9
Synonyms	NSC19509 BDBM50203564 SCHEMBL33954 BPBio1_000472 Tox21_110019_1 CAS-146-48-5 Yohimban-16-carboxylic acid, 17-hydroxy-, methyl ester, (16alpha,17alpha)- (9CI) cid_8969 DSSTox_CID_20130 HMS1792N17 KBio2_000576 146-48-5 LS-162738 4-25-00-01237 (Beilstein Handbook Reference) MolPort-001-794-653 AN-23279 Prestwick2_000584 Bio1_000944 SPBio_002647 BRD-K35586044-003-11-3 Yocon CHEBI:10093 Yohimbe bark extract D08685 Yohimbol-16alpha-carboxylic acid, methyl ester (6CI) DTXSID9040130 HMS2234C18 (+)-Yohimbine KBio3_001031 17a-hydroxy-16a-methoxycarbonyl-yohimbane methyl (1S,15R,18S,19R,20S)-18-hydroxy-3,13-diazapentacyclo[11.8.0.0;{2,10}.0;{4,9}.0;{15,20}]henicosa-2(10),4,6,8-tetraene-19-carboxylate 65Y190 NCGC00025018-05 Aphrosol BCBcMAP01_000032 Quebrachine Bio2_000938 Thybine BSPBio_001236 Yohimban-16-alpha-carboxylic acid, 17-alpha-hydroxy-, methyl ester CHEMBL537669 Yohimbic acid methyl ester Yovital GTPL102 IDI1_002213 (1R,2S,4aR,13bS,14aS)-2-hydroxy-1,2,3,4,4a,5,7,8,13,13b,14,14a-dodecahydro-indolo[2'',3'':3,4]pyrido[1,2-b]isoquinoline-1-carboxylic acid methyl ester hydrochloride KBioSS_000576 2Y49VWD90Q methyl hydroxy[?]carboxylate AKOS015902024 NCGC00025018-10 Prestwick0_000584 Benz[g]indolo[2,3-a]quinolizine, yohimban-16-carboxylic acid deriv. SMP1_000320 BRD-K35586044-001-02-6 trans-Quinolizidine yohimbine CCG-205284 Yohimban-16-carboxylic acid, 17-hydroxy-, methyl ester, (16alpha,17alpha)-(9CI) Corynine Yohimbine (DCF) DSSTox_GSID_40130 HMS1990N17 KBio2_003144 17-Hydroxy-yohimbane-16-carboxylic acid methyl ester MCULE-1043513122 MRF-0000020 APHRODINE API0006398 Prestwick3_000584 Bio1_001433 SR-01000075297 BRN 0097276 Yohimar Yohimbe Extract Yohimbine D0H4JM Yohimex EINECS 205-672-0 HY-12715 (16alpha,17alpha)-17-Hydroxy-yohimban-16-carboxylic acid methyl ester KBio3_001032 17alpha-hydroxyyohimban-16alpha-carboxylic acid methyl ester methyl (1S,15R,18S,19R,20S)-18-hydroxy-3,13-diazapentacyclo[11.8.0.0^{2,10}.0^{4,9}.0^{15,20}]henicosa-2(10),4,6,8-tetraene-19-carboxylate AC1L1S1D NCGC00025018-06 BDBM50013515 SC-25096 BLGXFZZNTVWLAY-SCYLSFHTSA-N Tox21_110019 C09256 Yohimban-16-carboxylic acid, 17-hydroxy-, methyl ester, (16alpha,17alpha)- cid_6169 Yohimbin DB01392 ZINC3860825 HMS1362N17 Johimbin Lopac0_001210 37247-87-3 MLS000728591 Amberlite CG-400 NCGC00025018-11 Prestwick1_000584 Bio1_000455 SMR000470778 BRD-K35586044-003-03-0 UNII-2Y49VWD90Q CCRIS 9415 Yohimban-16alpha-carboxylic acid, 17alpha-hydroxy-, methyl ester (8CI) CS-5173 YOHIMBINE CHLORIDE DSSTox_RID_79446 HMS2089G19 (+)-Yohimbin KBio2_005712 17-Hydroxyyohimban-16-carboxylic acid methyl ester methyl (16alpha,17alpha)-17-hydroxyyohimban-16-carboxylate NCGC00013260-01 Aphrodyne Baron-X Quebrachin Bio2_000458 SR-01000075297-5 BSPBio_000428 Yohimban-16-.alpha.-carboxylic acid, 17-.alpha.-hydroxy-, methyl ester CHEMBL15245 YOHIMBE HYDROCHLORIDE Dayto himbin Yoman GS-5751 I14-13374 (16alpha,17alpha)-17-hydroxyyohimban-16-carboxylic acid methyl ester KBioGR_000576 2-Hydroxy-1,2,3,4,4a,5,7,8,13,13b,14,14a-dodecahydro-indolo[2',3':3,4]pyrido[1,2-b]isoquinoline-1-carboxylic acid methyl ester methyl 17alpha-hydroxyyohimban-16alpha-carboxylate Actibine NCGC00025018-07 [ Show all ]
Inchi Key	BLGXFZZNTVWLAY-SCYLSFHTSA-N
Inchi ID	InChI=1S/C21H26N2O3/c1-26-21(25)19-15-10-17-20-14(13-4-2-3-5-16(13)22-20)8-9-23(17)11-12(15)6-7-18(19)24/h2-5,12,15,17-19,22,24H,6-11H2,1H3/t12-,15-,17-,18-,19+/m0/s1
PubChem CID	8969
ChEMBL	CHEMBL15245
IUPHAR	102
BindingDB	50013515, 50203564
DrugBank	DB01392
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	36.31 nM	PMID9605427	BindingDB
Ki	61.66 nM	PMID9605427	BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417