Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 2C
Species	Homo sapiens (Human)
Gene	HTR2C
Synonym	Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C 5-HT2C receptor 5-HTR2C 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled 5-hydroxytryptamine receptor 1C HTR1C 5-HT-1C [ Show all ]
Disease	Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse Generalized anxiety disorder; Major depressive disorder Major depressive disorder Metabolic disorders Psychotic disorders Mood disorder Neurological disease Obesity Obesity; Diabetes Migraine headaches Anxiety disorder Alcohol use disorders Aggressive non-hodgkin's lymphoma [ Show all ]
Length	458
Amino acid sequence	MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
UniProt	P28335
Protein Data Bank	6bqg, 6bqh
GPCR-HGmod model	P28335
3D structure model	This structure is from PDB ID 6bqg.
BioLiP	BL0404805, BL0404806
Therapeutic Target Database	T83813
ChEMBL	CHEMBL225
IUPHAR	8
DrugBank	BE0004957, BE0004881, BE0000533

Ligand

Name	Yohimbine
Molecular formula	C21H26N2O3
IUPAC name	methyl (1S,15R,18S,19R,20S)-18-hydroxy-1,3,11,12,14,15,16,17,18,19,20,21-dodecahydroyohimban-19-carboxylate
Molecular weight	354.45
Hydrogen bond acceptor	4
Hydrogen bond donor	2
XlogP	2.9
Synonyms	MRF-0000020 APHRODINE Prestwick0_000584 Benz[g]indolo[2,3-a]quinolizine, yohimban-16-carboxylic acid deriv. SMP1_000320 BRD-K35586044-001-02-6 trans-Quinolizidine yohimbine CCG-205284 Yohimban-16-carboxylic acid, 17-hydroxy-, methyl ester, (16alpha,17alpha)-(9CI) Corynine Yohimbine (DCF) DSSTox_GSID_40130 HMS1990N17 KBio2_003144 17-Hydroxy-yohimbane-16-carboxylic acid methyl ester MCULE-1043513122 methyl (1S,15R,18S,19R,20S)-18-hydroxy-3,13-diazapentacyclo[11.8.0.0^{2,10}.0^{4,9}.0^{15,20}]henicosa-2(10),4,6,8-tetraene-19-carboxylate AC1L1S1D NCGC00025018-06 API0006398 Prestwick3_000584 Bio1_001433 SR-01000075297 BRN 0097276 Yohimar Yohimbe Extract Yohimbine D0H4JM Yohimex EINECS 205-672-0 HY-12715 (16alpha,17alpha)-17-Hydroxy-yohimban-16-carboxylic acid methyl ester KBio3_001032 17alpha-hydroxyyohimban-16alpha-carboxylic acid methyl ester 37247-87-3 MLS000728591 Amberlite CG-400 NCGC00025018-11 BDBM50013515 SC-25096 BLGXFZZNTVWLAY-SCYLSFHTSA-N Tox21_110019 C09256 Yohimban-16-carboxylic acid, 17-hydroxy-, methyl ester, (16alpha,17alpha)- cid_6169 Yohimbin DB01392 ZINC3860825 HMS1362N17 Johimbin Lopac0_001210 methyl (16alpha,17alpha)-17-hydroxyyohimban-16-carboxylate NCGC00013260-01 Aphrodyne Prestwick1_000584 Bio1_000455 SMR000470778 BRD-K35586044-003-03-0 UNII-2Y49VWD90Q CCRIS 9415 Yohimban-16alpha-carboxylic acid, 17alpha-hydroxy-, methyl ester (8CI) CS-5173 YOHIMBINE CHLORIDE DSSTox_RID_79446 HMS2089G19 (+)-Yohimbin KBio2_005712 17-Hydroxyyohimban-16-carboxylic acid methyl ester methyl 17alpha-hydroxyyohimban-16alpha-carboxylate Actibine NCGC00025018-07 Baron-X Quebrachin Bio2_000458 SR-01000075297-5 BSPBio_000428 Yohimban-16-.alpha.-carboxylic acid, 17-.alpha.-hydroxy-, methyl ester CHEMBL15245 YOHIMBE HYDROCHLORIDE Dayto himbin Yoman GS-5751 I14-13374 (16alpha,17alpha)-17-hydroxyyohimban-16-carboxylic acid methyl ester KBioGR_000576 2-Hydroxy-1,2,3,4,4a,5,7,8,13,13b,14,14a-dodecahydro-indolo[2',3':3,4]pyrido[1,2-b]isoquinoline-1-carboxylic acid methyl ester 4-25-00-01237 (Beilstein Handbook Reference) MolPort-001-794-653 AN-23279 NSC19509 BDBM50203564 SCHEMBL33954 BPBio1_000472 Tox21_110019_1 CAS-146-48-5 Yohimban-16-carboxylic acid, 17-hydroxy-, methyl ester, (16alpha,17alpha)- (9CI) cid_8969 DSSTox_CID_20130 HMS1792N17 KBio2_000576 146-48-5 LS-162738 methyl (1S,15R,18S,19R,20S)-18-hydroxy-3,13-diazapentacyclo[11.8.0.0;{2,10}.0;{4,9}.0;{15,20}]henicosa-2(10),4,6,8-tetraene-19-carboxylate 65Y190 NCGC00025018-05 Aphrosol Prestwick2_000584 Bio1_000944 SPBio_002647 BRD-K35586044-003-11-3 Yocon CHEBI:10093 Yohimbe bark extract D08685 Yohimbol-16alpha-carboxylic acid, methyl ester (6CI) DTXSID9040130 HMS2234C18 (+)-Yohimbine KBio3_001031 17a-hydroxy-16a-methoxycarbonyl-yohimbane 2Y49VWD90Q methyl hydroxy[?]carboxylate AKOS015902024 NCGC00025018-10 BCBcMAP01_000032 Quebrachine Bio2_000938 Thybine BSPBio_001236 Yohimban-16-alpha-carboxylic acid, 17-alpha-hydroxy-, methyl ester CHEMBL537669 Yohimbic acid methyl ester Yovital GTPL102 IDI1_002213 (1R,2S,4aR,13bS,14aS)-2-hydroxy-1,2,3,4,4a,5,7,8,13,13b,14,14a-dodecahydro-indolo[2'',3'':3,4]pyrido[1,2-b]isoquinoline-1-carboxylic acid methyl ester hydrochloride KBioSS_000576 [ Show all ]
Inchi Key	BLGXFZZNTVWLAY-SCYLSFHTSA-N
Inchi ID	InChI=1S/C21H26N2O3/c1-26-21(25)19-15-10-17-20-14(13-4-2-3-5-16(13)22-20)8-9-23(17)11-12(15)6-7-18(19)24/h2-5,12,15,17-19,22,24H,6-11H2,1H3/t12-,15-,17-,18-,19+/m0/s1
PubChem CID	8969
ChEMBL	CHEMBL15245
IUPHAR	102
BindingDB	50013515, 50203564
DrugBank	DB01392
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
	N/A	N/A	DrugBank
Ki	<10000.0 nM	PMID9225287, PMID7582481	BindingDB
Ki	645.65 nM	PMID9225287	BindingDB
Ki	1000.0 nM	PMID10611634	BindingDB
Ki	1690.0 nM	PMID8632342	BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417