Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Delta-type opioid receptor
Species	Mus musculus (Mouse)
Gene	Oprd1
Synonym	OP1 MSL-2 K56 DOR-1 DOR DOPr DOP Delta receptor D-OR-1 opioid receptor [ Show all ]
Disease	N/A for non-human GPCRs
Length	372
Amino acid sequence	MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTACTPSDGPGGGAAA
UniProt	P32300
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL3222
IUPHAR	317
DrugBank	N/A

Ligand

Name	fentanyl
Molecular formula	C22H28N2O
IUPAC name	N-phenyl-N-[1-(2-phenylethyl)piperidin-4-yl]propanamide
Molecular weight	336.479
Hydrogen bond acceptor	2
Hydrogen bond donor	0
XlogP	4.0
Synonyms	CHEMBL596 PDSP1_000860 DSSTox_CID_3049 Propionanilide, N-(1-phenethyl-4-piperidyl)- Duragesic-25 Subsys (TN) Fentanest fentanyl (transmucosal film, pain), Auxilium Pharmaceuticals Fentanyl [INN:BAN] Fentanyl-75 9235-EP2280008A2 HSDB 3329 9235-EP2314585A1 N-(1-(2-phenylethyl)-4-piperidinyl)-N-phenylpropanamide API0002693 N-Phenethyl-4-(N-propionylanilino)piperidine N-phenyl-N-[1-(2-phenylethyl)piperidin-4-yl]propanamide D00320 Phentanyl DTXSID9023049 SCHEMBL8804 Durogesic UNII-UF599785JZ Fentanila Fentanyl buccal Fentanyl-12 Fentanylum 9235-EP2298768A1 JNS020QD 990-73-8 (citrate) N-(1-Phenethyl-piperidin-4-yl)-N-phenyl-propionamide BRN 0494484 CHEBI:119915 Oprea1_207148 Propanamide, N-phenyl-N-(1-(2-phenylethyl)-4-piperidinyl)- (9CI) Duragesic-100 Sublimaze EINECS 207-113-6 Fentanyl solution, 100 mug/mL in methanol, ampule of 1 mL, certified reference material 1-Phenethyl-4-(N-phenylpropionamido)piperidine Fentanyl-50 9235-EP2277861A1 FT-0668508 9235-EP2308509A1 LS-124439 ACN-S001735 N-(1-Phenethylpiperidin-4-yl)-N-phenylpropionamide CS-7211 PDSP2_000846 DSSTox_GSID_23049 R 4263 Duragesic-50 Tox21_112611 Fentanil Fentanyl 0.1 mg/ml in Methanol Fentanyl [USAN:USP:INN:BAN] 437-38-7 Fentanyl-87 9235-EP2298764A1 HY-U00158 9235-EP2314590A1 N-(1-Phenethyl-4-piperidinyl)-N-phenylpropionamide BDBM50008984 N-Phenyl-N-(1-(2-phenylethyl)-4-piperidinyl)propanamide NCGC00168252-01 D09ISU PJMPHNIQZUBGLI-UHFFFAOYSA-N Duragesic Sentonil Durotep MT ZINC2522669 Fentanila [INN-Spanish] Fentanyl CII Fentanyl-25 80832-90-2 Fentanylum [INN-Latin] 9235-EP2305652A2 L001275 Abstral N-(1-Phenethyl-piperidin-4-yl)-N-phenyl-propionamide(Fentanyl) CAS-437-38-7 pain therapy (transmucosal film), Auxilium Pharmaceuticals DB00813 Propanamide, N-phenyl-N-[1-(2-phenylethyl)-4-piperidinyl]- Duragesic-12 Subsys Epitope ID:153507 Fentanyl (JAN/USAN/INN) Fentanyl Transdermal System 1-Phenethyl-4-N-propionylanilinopiperidine Fentanyl-62 9235-EP2277875A2 GTPL1626 9235-EP2308872A1 Matrifen Actiq N-(1-Phenylethyl-4-piperidinyl)propionanilide N-Phenyl-N-[1-(2-phenylethyl)-4-piperidinyl]propanamide # CTK8G2863 PecFent DSSTox_RID_76851 R4263 Duragesic-75 UF599785JZ Fentanil [DCIT] Fentanyl 1.0 mg/ml in Methanol Fentanyl-100 5-22-08-00049 (Beilstein Handbook Reference) FENTANYL-HCl 9235-EP2298765A1 IONSYS 9235-EP2316829A1 N-(1-Phenethyl-4-piperidyl)propionanilide BIDD:GT0555 Oprea1_152073 D0E1WI Propanamide, N-phenyl-N-(1-(2-phenylethyl)-4-piperidinyl)- Duragesic (TN) Sublimase effentora Fentanilo Fentanyl solution, 1.0 mg/mL in methanol, ampule of 1 mL, certified reference material 1-(2-Phenylethyl)-4-(N-propananilido)piperidine Fentanyl-37 9235-EP2275420A1 Fentora 9235-EP2305654A1 Lazanda AC1L1FQ2 N-(1-phenethylpiperidin-4-yl)-N-phenylpropanamide CF0052 [ Show all ]
Inchi Key	PJMPHNIQZUBGLI-UHFFFAOYSA-N
Inchi ID	InChI=1S/C22H28N2O/c1-2-22(25)24(20-11-7-4-8-12-20)21-14-17-23(18-15-21)16-13-19-9-5-3-6-10-19/h3-12,21H,2,13-18H2,1H3
PubChem CID	3345
ChEMBL	CHEMBL596
IUPHAR	1626
BindingDB	50008984
DrugBank	DB00813
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
IC50	3.45 nM	PMID26299827	ChEMBL
IC50	3.5 nM	PMID26299827	BindingDB
IC50	7.2 nM	PMID21925887	BindingDB
IC50	9.4 nM	PMID23623418	ChEMBL
IC50	9.45 nM	PMID20218625	BindingDB,ChEMBL
IC50	9.5 nM	PMID26323872	BindingDB,ChEMBL
IC50	9400.0 nM	PMID26712115	BindingDB,ChEMBL
Ki	568.0 nM	PMID26299827	BindingDB,ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417