Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Muscarinic acetylcholine receptor M5
Species	Homo sapiens (Human)
Gene	CHRM5
Synonym	M5R M5 receptor cholinergic receptor cholinergic receptor, muscarinic 5
Disease	Urinary incontinence Colitis Dysmenorrhea Irritable bowel syndrome Myasthenia gravis Neurological disease Schizophrenia Stomach ulcer Cognitive disorders Chronic obstructive pulmonary disease Allergic rhinitis Central and peripheral nervous diseases Brain diseases Amnesia [ Show all ]
Length	532
Amino acid sequence	MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
UniProt	P08912
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	T79961
ChEMBL	CHEMBL2035
IUPHAR	17
DrugBank	BE0000247, BE0004890

Ligand

Name	tropicamide
Molecular formula	C17H20N2O2
IUPAC name	N-ethyl-3-hydroxy-2-phenyl-N-(pyridin-4-ylmethyl)propanamide
Molecular weight	284.359
Hydrogen bond acceptor	3
Hydrogen bond donor	1
XlogP	1.5
Synonyms	HMS2235J15 Tox21_501223 HY-B0321 AB00052120_12 Tropicamide (JP17/USP/INN) KBio2_003632 Akorn Brand of Tropicamide Tropicamide Monohydrochloride, (S)-Isomer Lopac0_001223 BDBM82371 Tropicamide, (R)-Isomer MLS002154240 Bournonville Brand of Tropicamide Tropimil N-Ethyl-2-phenyl-N-(4-pyridylmethyl)hydracrylamide Pharmafair Brand of Tropicamide CAS-1508-75-4 n-ethyl-n-(g-picolyl)tropamide Rivex Brand of Tropicamide component of Paremyd NCGC00016065-09 SMR000058523 DivK1c_000448 NINDS_000448 Spectrum5_001585 EU-0101223 Ocusoft Brand of Tropicamide STK934612 SW196691-3 HMS3267A13 508T754 Tropicamid I06-0811 AC-816 Tropicamide Faure KBioGR_000873 AM84467 Tropicamide Pharmafair Brand MCULE-4102613027 Benzeneacetamide, N-ethyl-alpha-(hydroxymethyl)-N-(4-pyridinylmethyl)-, (+-)- Tropicamide, solid Mydriacyl BRD-A79672927-001-10-8 N-ethyl-3-hydroxy-2-phenyl-N-(4-pyridylmethyl)propanamide Prestwick1_000228 Chauvin Brand of Tropicamide NCGC00016065-04 s1913 CTK4C6796 NCGC00024866-03 Spectro-Cyl DSSTox_RID_80757 NSC757372 SR-01000075351-1 HMS1568N17 Tox21_110297 HMS3712N17 AB00052120-10 KBio1_000448 ACN-036667 Tropicamide Monofree KS-5174 BBL028074 Tropicamide [USAN:USP:INN:BAN:JAN] Minims tropicamide BGDKAVGWHJFAGW-UHFFFAOYSA-N Tropicamidum [INN-Latin] Mydriaticum Opticyl BSPBio_002289 N-Ethyl-N-(4-pyridylmethyl)tropamid Prestwick_487 CHEMBL1200604 NCGC00016065-07 SCHEMBL23975 NCGC00024866-06 Spectrum3_000655 EINECS 216-140-2 Ocu-Tropic SR-01000075351-7 HMS2092A18 HMS3259M18 1508-75-4 Triaminic DM Hydracrylamide, N-ethyl-2-phenyl-N-(4-pyridylmethyl)- AB0011259 Tropicamide Alcon Brand KBio2_006200 AKOS005664076 Tropicamide Novartis Brand LP01223 Benzeneacetamide, N-ethyl-.alpha.-(hydroxymethyl)-N-(4-pyridinylmethyl)- Tropicamide, (S)-Isomer MolPort-000-159-321 BPBio1_000303 Visumidriatic N-Ethyl-2-phenyl-N-4-[-pyridyl-methyl]hydracrylamide Pharmakon1600-01500599 CAS_1508-75-4 NC00589 Ro 1-7683 CPD000058523 NCGC00016065-11 SPBio_000872 DSSTox_CID_25220 Novartis Brand of Tropicamide Spectrum_000584 FT-0657590 OcuTropic Stulln Brand 1 of Tropicamide T 9778 HMS3373B07 Tropicamida IDI1_000448 AC1L1KOZ Tropicamide for peak identification, European Pharmacopoeia (EP) Reference Standard KBioSS_001064 AN-15530 Tropicamide Rivex Brand Medical Ophthalmics Brand of Tropicamide Benzeneacetamide,N-ethyl-a-(hydroxymethyl)-N-(4-pyridinylmethyl)- Tropicamide, United States Pharmacopeia (USP) Reference Standard Mydriacyl (TN) BRN 0285563 N-ethyl-3-hydroxy-2-phenyl-N-(pyridin-4-ylmethyl)propanamide Prestwick2_000228 CHEBI:9757 NCGC00016065-05 SAM002564235 D00397 NCGC00024866-04 SPECTRUM1500599 DTXSID8045220 NSC_5593 SR-01000075351-3 HMS1921I09 (+-)-N-Ethyl-2-phenyl-N-(4-pyridylmethyl)hydracrylamide Tox21_110297_1 HMS501G10 AB00052120_11 Tropicamide (JP15/USP/INN) KBio2_001064 AK164485 Tropicamide Monohydrochloride, (R)-Isomer L001262 BCP13504 Tropicamide, (+-)-Isomer MLS001306442 Bistropamide Tropikamid Mydrum Paremyd Cahill May Roberts Brand of Tropicamide N-Ethyl-N-(4-pyridylmethyl)tropamide Q-201902 Colircusi Tropicamida NCGC00016065-08 SMP1_000304 DB00809 NCGC00261908-01 Spectrum4_000377 Epitromina Ocumed Brand of Tropicamide ST51015162 HMS2095N17 HMS3263F08 5-22-09-00359 (Beilstein Handbook Reference) Tropicacyl I-Picamide AB2000370 Tropicamide Chauvin Brand KBio3_001509 Alcon Brand of Tropicamide Tropicamide Ocumed Brand LS-28545 Benzeneacetamide, N-ethyl-alpha-(hydroxymethyl)-N-(4-pyridinylmethyl)- Tropicamide, European Pharmacopoeia (EP) Reference Standard Mydral BRD-A79672927-001-05-8 N-Ethyl-3-hydroxy-2-phenyl-N-(4-pyridinylmethyl)propanamide # Prestwick0_000228 CCG-40076 NCGC00016065-03 RP29909 CS-2362 NCGC00024866-02 SPBio_002196 DSSTox_GSID_45220 NSC-757372 SR-01000075351 GTPL7319 Stulln Brand 2 of Tropicamide TL8001101 HMS3651K04 AB00052120 Tropicamida [INN-Spanish] K-4793 AC1Q5IFA Tropicamide Minims KS-00000H8Q API0004531 Tropicamide [USAN:INN:BANJAN] MFCD00058580 BG0349 Tropicamidum Mydriafair BSPBio_000275 N-Ethyl-alpha-(hydroxymethyl)-N-(4-pyridinylmethyl)benzeneacetamide Prestwick3_000228 NCGC00016065-06 SBI-0051190.P003 D09PNY NCGC00024866-05 Spectrum2_000936 EBD22886 Ocu Tropic SR-01000075351-5 HMS2089M05 [ Show all ]
Inchi Key	BGDKAVGWHJFAGW-UHFFFAOYSA-N
Inchi ID	InChI=1S/C17H20N2O2/c1-2-19(12-14-8-10-18-11-9-14)17(21)16(13-20)15-6-4-3-5-7-15/h3-11,16,20H,2,12-13H2,1H3
PubChem CID	5593
ChEMBL	CHEMBL1200604
IUPHAR	N/A
BindingDB	82371
DrugBank	DB00809
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
IC50	89.0 nM	DrugMatrix in vitro pharmacology data	ChEMBL
Ki	64.0 nM	DrugMatrix in vitro pharmacology data	ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417