Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Ligand

Name	NAPTALAM
Molecular formula	C18H13NO3
IUPAC name	2-(naphthalen-1-ylcarbamoyl)benzoic acid
Molecular weight	291.306
Hydrogen bond acceptor	3
Hydrogen bond donor	2
XlogP	3.5
Synonyms	Kyselina N-1-naftylftalamova [Czech] 2-(N-naphthylcarbamoyl)benzoic acid N-(1-naphthalenyl)phthalamic acid 6Q8 N-1-Naphthylphthalamate AJ-08466 Naftalam [Czech] Alanap Plus Naptalame [ISO-French] Ancrack NSC204421 Benzoic acid, 2-[(1-naphthalenylamino)carbonyl]- (9CI) Phthalamic acid, N-1-naphthyl- (7CI,8CI) CHEMBL2447888 SR-01000392378-1 EPA Pesticide Chemical Code 030702 IFLab1_001003 112284-33-0 2-((1-naphthalenylamino)carbonyl)-benzoicaci MCULE-3496128683 2-[(1-Naphthylamino)carbonyl]benzoic acid N-(1-Naphthyl)phthalamidic acid ACMC-209bpp N-1-napthylphthalamic acid Alanap alanap10g Nip-a-thin BB0274029 Oprea1_469302 C18869 RTR-004458 DSSTox_CID_12437 Tox21_302279 FT-0629075 JXTHEWSKYLZVJC-UHFFFAOYSA- KS-00004AUE 2-((1-Naphthalenylamino)carbonylbenzoic acid N - (1 - Naphthyl)phthalamic acid 3-12-00-02876 (Beilstein Handbook Reference) N-1-Naphthyl-phthalamidsaeure AE-017/30049056 N0067 Alanap 10G at Naptalam, PESTANAL(R), analytical standard alpha-Naphthylphthalamic acid NSC 204421 Benzoic acid, 2-((1-naphthalenylamino)carbonyl)- (9CI) Phthalamic acid, N-1-naphthyl CBDivE_002040 Solo (Salt/Mix) DTXSID6032437 HSDB 1742 1-N-Naphthylphthalamic acid ZINC28113 132-66-1 L001060 2-(naphthalen-1-ylcarbamoyl)benzoic acid N-(1-Naphthyl)phthalamic acid N-1-Naphthylphthalamic acid AK-57895 Naphthalam Alanap-2 Naptro ANW-19451 NSC_8594 Benzoic acid, 2-[(naphthalenylamino)carbonyl]- Phthalamic acid,N-1-naphthyl- CTK0D2202 ST001288 F0290-1094 InChI=1/C18H13NO3/c20-17(14-9-3-4-10-15(14)18(21)22)19-16-11-5-7-12-6-1-2-8-13(12)16/h1-11H,(H,19,20)(H,21,22) 2-((1-Naphthalenylamino)carbonyl)benzoic acid MolPort-000-389-108 2-[(1-Naphthylamino)carbonyl]benzoic acid # N-.alpha.-Naphthylphthalamic acid ACP 322 N-alpha-Naphthylphthalamic acid Alanap 1 Naptalam [BSI:ISO] alanap10gat NPA (VAN) BDBM81777 Peach Thin 322 CAS-132-66-1 SBB008186 DSSTox_GSID_32437 UNII-306R88V86P Grelutin .alpha.-Naphthylphthalamic acid JXTHEWSKYLZVJC-UHFFFAOYSA-N Kyselina N-1-naftylftalamova 2-(1-Naphthylcarbamoyl)benzoic acid N-(.alpha.-Naphthyl)phthalamic acid 306R88V86P N-1-Naphthyl-phthalamidsaeure [German] AI3-23463 Naftalam Alanap 3 Naptalame Analape NSC-204421 Benzoic acid, 2-[(1-naphthalenylamino)carbonyl]- Phthalamic acid, N-1-naphthyl- CHEBI:60833 SR-01000392378 Dyanap I14-18114 1-Naphthylphthalamic acid [3H]-NPA 132-67-2 (hydrochloride salt) LS-109086 2-[(1-Naphthalenylamino)carbonylbenzoic acid N-(1-Naphthyl)phthalamicAcid AC1L1RBG N-1-Naphthylphthalamidic acid AKOS000485934 Naphthylphthalamic acid alanap1 NCGC00255281-01 ARONIS018728 Oprea1_065903 BRN 2814102 Premerge plus (Salt/Mix) Cyanap STK072761 FR-1032 J-006203 KS-000013CA 2-((1-naphthalenylamino)carbonyl)benzoicacid Mor-Cran 2-[N-(1-naphthylcarbamoyl)]benzoic acid N-1-Naphthalenephthalamic acid acp322 N-Naphthalen-1-yl-phthalamic acid Alanap 10G Naptalam, analytical standard Alanape NPA,(-) Benzoic acid, 2-((1-naphthalenylamino)carbonyl)- Peach-Thin Caswell No. 592 SCHEMBL54940 DSSTox_RID_78947 WLN: L66J BMVR BVQ HMS1414N13 1-(N-Naphthyl)Phthalamic acid [ Show all ]
Inchi Key	JXTHEWSKYLZVJC-UHFFFAOYSA-N
Inchi ID	InChI=1S/C18H13NO3/c20-17(14-9-3-4-10-15(14)18(21)22)19-16-11-5-7-12-6-1-2-8-13(12)16/h1-11H,(H,19,20)(H,21,22)
PubChem CID	8594
ChEMBL	N/A
IUPHAR	N/A
BindingDB	81777
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	14.0 nM	PMID8097160	PDSP,BindingDB
Ki	257.0 nM	PMID8097160	PDSP
Ki	290.7 nM	PMID8102973	PDSP,BindingDB
Ki	2391.0 nM	PMID12023553	PDSP,BindingDB
Ki	3243.0 nM	PMID12023553	PDSP,BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417