Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 1D
Species	Sus scrofa (Pig)
Gene	HTR1D
Synonym	5-HT-1D 5-HT1D Serotonin receptor 1D
Disease	N/A for non-human GPCRs
Length	291
Amino acid sequence	AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIYSTCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSLHEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVASLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
UniProt	P79400
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL4105
IUPHAR	N/A
DrugBank	N/A

Ligand

Name	tryptamine
Molecular formula	C10H12N2
IUPAC name	2-(1H-indol-3-yl)ethanamine
Molecular weight	160.22
Hydrogen bond acceptor	1
Hydrogen bond donor	2
XlogP	1.6
Synonyms	CS-D1750 EC 200-510-5 005T661 HMS2267B18 2-(1H-Indol-3-yl)ethanamine # KB-81364 3-(2-amino)ethyl indole KSC354A2B 34685-69-3 (unspecified sulfate) MLS000515794 AC1L1AU8 NCGC00014994-07 AJ-11665 PubChem9450 BBL015353 Tryptamin SMR000112268 BRN 0125513 V2315 SR-01000075589 [2-(1h-indol-3-yl)ethyl]amine ST50308344 DB-005731 (3-Indolyl)ethylamine FS-3317 2-(1h-indol-3-yl) ethylamine HY-B2132 2-(3-Indolyl)ethylamine; 3-(2-Aminoethyl)indole KBio2_002961 3-Indoleethanamine Lopac0_000061 NCGC00014994-02 ACN-000556 NCGC00095081-03 AM807158 T-8100 SBB003963 beta-(3-Indolyl)ethylamine Tryptamine, analytical standard Spectrum2_000873 CCG-40088 DTXSID2075340 GTPL125 2-(1H-Indol-3-Yl)Ethan-1-Amine Indol-3-ethylamine 2-indol-3-yl-ethylamine KBioGR_001459 3-[2-Aminoethyl]indole MCULE-6402431765 AB0007015 NCGC00014994-05 ACT09907 NINDS_000862 APJYDQYYACXCRM-UHFFFAOYSA-N TRA0076983 SCHEMBL26725 BR-80344 tryptaminium Spectrum5_001296 CTK2F4020 EINECS 200-510-5 HMS502L04 2-(1H-indol-3-yl)ethylamine KBio1_000862 3-(2-aminoethyl)indole L000946 422ZU9N5TV MolPort-001-002-280 AC1Q54C3 NCGC00095081-01 AKOS000119468 RP22361 BCP21605 SPBio_000945 BSPBio_003400 VI30132 SR-01000075589-5 STK262895 DB08653 (Amino-2 ethyl)-3 indole FT-0081340 2-(1H-indol-3-yl)-ethyl-amine IDI1_000862 2-(Indol-3-yl)ethylamine KBio2_005529 3-Indoleethylamine LS-82268 5E7B376B-5933-446C-9D88-661B5F480122 NCGC00014994-03 ACN-036699 NCGC00095081-04 AN-41829 T0890 SC-05762 bmse000207 Tryptamine, free base Spectrum3_001890 CCRIS 8959 CHEMBL6640 EBD10651 .beta.-(3-Indolyl)ethylamine HMS1922K18 2-(1H-Indol-3-yl)ethanamine Indole, 3-(2-aminoethyl)- 2-Indol-3-ylethylamine KBioSS_000393 343-94-2 (mono-hydrochloride) MFCD00005661 AB1001199 NCGC00014994-06 AE-848/30735051 Oprea1_870097 AZ0001-0257 triptamine SDCCGMLS-0066798.P001 BRD-K44218819-001-05-1 UNII-422ZU9N5TV Spectrum_000033 ST2409261 D08CJK F2169-0960 1H-Indole-3-ethanamine HTS028111 2-(3-Indolyl)ethylamine KBio2_000393 3-(beta-aminoethyl)-indole Lopac-246557 5-22-10-00045 (Beilstein Handbook Reference) NCGC00014994-01 ACMC-209mtp NCGC00095081-02 ALBB-017957 RTC-066345 BDBM50024210 Tryptamine, 98% SPECTRUM1503922 C00398 ZINC120144 T-8095 DivK1c_000862 (Amino-2 ethyl)-3 indole [French] FT-0613523 2-(1H-INDOL-3-YL)-ETHYLAMINE InChI=1/C10H12N2/c11-6-5-8-7-12-10-4-2-1-3-9(8)10/h1-4,7,12H,5-6,11H 2-Indol-3-yl-aethylamin KBio3_002903 3-indolylethylamine M-3012 61-54-1 NCGC00014994-04 ACN-F000556 NCGC00095081-05 ANW-33851 TC-066345 SCHEMBL13006684 BP-12561 Tryptamine, Vetec(TM) reagent grade, 98% Spectrum4_000850 CHEBI:16765 [ Show all ]
Inchi Key	APJYDQYYACXCRM-UHFFFAOYSA-N
Inchi ID	InChI=1S/C10H12N2/c11-6-5-8-7-12-10-4-2-1-3-9(8)10/h1-4,7,12H,5-6,11H2
PubChem CID	1150
ChEMBL	CHEMBL6640
IUPHAR	125
BindingDB	50024210
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	224.0 nM	Waeber et al., PMID1988	PDSP

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417