NPLLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLITLGKAHHLDAHYITRLFQLIIEDS
VLTQQALLQQH
The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1ecm:B | 95 | 90 | 0.9890 | 0.9474 | 1.0000 | 1.22e-57 | 1ecm:A |
2 | 2gtv:X | 104 | 96 | 0.3297 | 0.2885 | 0.3125 | 4.95e-08 | |
3 | 2ao2:A | 165 | 58 | 0.2088 | 0.1152 | 0.3276 | 0.001 | 2ao2:B, 2ao2:C, 2fp2:B |
4 | 5ckx:D | 79 | 54 | 0.2308 | 0.2658 | 0.3889 | 0.009 | 5ckx:C, 2w1a:C, 2w1a:D |
5 | 8pnj:A | 390 | 77 | 0.2527 | 0.0590 | 0.2987 | 0.068 | |
6 | 6al9:B | 91 | 85 | 0.2747 | 0.2747 | 0.2941 | 0.081 | 6al9:A |
7 | 5gmu:B | 87 | 51 | 0.2088 | 0.2184 | 0.3725 | 0.092 | 5gmu:A |
8 | 5j6f:A | 352 | 74 | 0.2418 | 0.0625 | 0.2973 | 0.88 | 5j6f:B |
9 | 8gix:E | 991 | 61 | 0.2198 | 0.0202 | 0.3279 | 0.92 | |
10 | 6ntw:A | 505 | 64 | 0.2088 | 0.0376 | 0.2969 | 1.1 | |
11 | 4lps:A | 215 | 74 | 0.2308 | 0.0977 | 0.2838 | 1.9 | 4lps:B |
12 | 1l3l:B | 233 | 27 | 0.1209 | 0.0472 | 0.4074 | 3.7 | 1h0m:A, 1h0m:B, 1h0m:C, 1h0m:D, 1l3l:D, 1l3l:A, 1l3l:C |
13 | 5ne1:B | 270 | 28 | 0.1648 | 0.0556 | 0.5357 | 5.6 | 5ne2:A, 5ne2:B, 5ne3:A, 5ne3:B, 6qw7:A, 6qw7:B |