MKISGRNKLEATVKEIVKGTVMAKIVMDYKGTELVAAITIDSVADLDLVPGDKVTALVKATEMEVLK
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1fr3:A | 67 | 67 | 1.0000 | 1.0000 | 1.0000 | 5.40e-41 | 1fr3:D, 1fr3:B, 1fr3:E, 1fr3:F, 1fr3:C, 1fr3:G, 1fr3:J, 1fr3:I, 1fr3:H, 1fr3:K, 1fr3:L |
2 | 1h9m:A | 141 | 63 | 0.3582 | 0.1702 | 0.3810 | 2.83e-07 | 1h9m:B |
3 | 1h9m:A | 141 | 61 | 0.3582 | 0.1702 | 0.3934 | 1.73e-05 | 1h9m:B |
4 | 1gug:A | 67 | 65 | 0.3582 | 0.3582 | 0.3692 | 1.12e-06 | 1gug:B, 1gug:C, 1gug:D, 1gug:E, 1gug:F, 1gun:A, 1gun:B, 1gun:C, 1gun:D, 1gun:E, 1gun:F, 1guo:A, 1guo:B, 1guo:C, 1guo:D, 1guo:E, 1guo:F |
5 | 9bed:A | 74 | 64 | 0.3433 | 0.3108 | 0.3594 | 3.53e-06 | 9beb:A, 9beb:E, 9beb:C, 9beb:F, 9beb:B, 9beb:D, 9bed:D, 9bed:C, 9bed:F, 9bed:B, 9bed:E, 9bel:A, 9bel:C, 9bel:B, 9bel:E, 9bel:D, 9bel:F, 9bem:A, 9bem:C, 9bem:B, 9bem:E, 9bem:F, 9bem:D, 9beo:A, 9beo:E, 9beo:C, 9beo:B, 9beo:D, 9beo:F, 9d2c:A, 9d2c:D, 9d2c:B, 9d2c:C, 9d2c:E, 9d2c:F, 9d2c:H, 9d2c:K, 9d2c:J, 9d2c:I, 9d2c:L, 9d2c:M |
6 | 8ip8:EB | 399 | 47 | 0.2388 | 0.0401 | 0.3404 | 1.4 | 8ipa:EB, 8ipb:EB |
7 | 8jiv:CC | 376 | 47 | 0.2388 | 0.0426 | 0.3404 | 4.4 | |
8 | 1gwi:A | 402 | 32 | 0.2388 | 0.0398 | 0.5000 | 5.5 | 1gwi:B |
9 | 4v3p:LD | 372 | 47 | 0.2388 | 0.0430 | 0.3404 | 6.0 | 4v7e:CC |