BioLiP

>protein
MALSDSQIFLALALALIPGFLALRLATELYK

The query sequence (length=31) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7s3d:M	31	31	1.0000	1.0000	1.0000	7.79e-15	7s3d:V, 7s3d:m
2	7qco:T	31	31	0.7097	0.7097	0.7097	3.48e-11	6vpv:M, 6vpv:m, 6vpv:z
3	6k61:M	31	30	0.6452	0.6452	0.6667	6.20e-10	6jeo:aM, 6jeo:bM, 6jeo:cM, 6jeo:dM, 6k61:m, 7lx0:V, 7lx0:m, 7lx0:M, 6pnj:M, 6pnj:V, 6pnj:m, 6tcl:M1, 6tcl:M2, 6tcl:M, 6tcl:MM, 7y3f:M
4	8am5:m	31	31	0.7097	0.7097	0.7097	2.45e-09	8asl:m, 8asp:m, 6hqb:M, 4kt0:M, 4l6v:M, 4l6v:m, 4l6v:7, 6nwa:M, 6nwa:m, 6nwa:V, 7o1v:M, 5oy0:M, 5oy0:m, 5oy0:9, 7umh:M, 7umh:V, 7umh:m, 6uzv:M, 6uzv:m, 6uzv:9
5	6kmw:aM	31	31	0.6129	0.6129	0.6129	4.15e-09	6kmw:bM, 6kmw:cM, 6kmx:aM, 6kmx:bM, 6kmx:cM
6	4fe1:M	31	31	0.6129	0.6129	0.6129	5.22e-09	7fix:M1, 7fix:M2, 7fix:M3, 1jb0:M, 6k33:aM, 6k33:bM, 6k33:cM, 6lu1:M, 7m75:M, 7m76:M, 3pcq:M, 6pfy:M, 6pfy:V, 6pfy:i, 6pgk:M, 6pgk:V, 6tra:M, 6trc:M, 6trc:m, 6trc:y, 6trd:m, 6trd:y, 5zf0:M1, 5zf0:M2, 5zf0:M3, 5zf0:M4, 5zf0:M6, 5zf0:M5
7	7yca:M	31	31	0.6452	0.6452	0.6452	5.02e-08
8	6igz:M	31	30	0.6129	0.6129	0.6333	2.19e-07
9	7xqp:M	32	30	0.5484	0.5312	0.5667	2.34e-05	8htu:M, 7ksq:M, 7kux:M
10	8wm6:M	30	29	0.5161	0.5333	0.5517	2.41e-04	8wmj:M, 8wmv:M, 8wmw:M, 7y7b:M, 7y8a:M
11	7a4p:M	31	31	0.5161	0.5161	0.5161	4.18e-04	6zzx:M, 6zzy:M
12	6l4u:M	30	27	0.3871	0.4000	0.4444	0.001
13	7y5e:MN	30	28	0.5161	0.5333	0.5714	0.95	7y5e:M2, 7y7a:M7, 7y7a:Mo
14	6elq:X	630	22	0.3226	0.0159	0.4545	4.1	6elq:A, 6elq:B

[Back]