Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP Library
>protein
LKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTD
PGWVDDSRIQWGNK

The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 2djh:A 96 92 0.9787 0.9583 1.0000 4.18e-63 2a8k:D, 2a8k:C, 2a8k:B, 2a8k:A, 3vj7:A
2 4v4p:AD 173 50 0.1915 0.1040 0.3600 0.92 4v4r:BD, 4v4s:BD, 4v4t:BD
3 5li0:D 275 23 0.1277 0.0436 0.5217 0.93 7asm:C, 7asn:F, 7asp:C, 6ddd:B, 6ddg:B, 6fxc:AC, 6fxc:BC, 5hkv:A, 5hl7:A, 6hma:C, 5nd8:D, 5nd9:D, 5ngm:AC, 7nhl:G, 7nhm:G, 5nrg:A, 8p2f:G, 8p2g:G, 8p2h:G, 7p48:C, 6s0x:C, 6s0z:C, 6s12:C, 6s13:C, 6sj6:D, 5t7v:L2, 5tcu:L2, 7ttu:B, 7ttw:B, 4wce:A, 4wf9:A, 4wfa:A, 4wfb:A, 6wqn:B, 6wqq:B, 6wrs:B, 6wru:B, 8y36:C, 8y37:C, 8y38:C, 8y39:C, 6yef:D
4 8kd6:E 301 50 0.1809 0.0565 0.3400 1.3 8kd2:E
5 5t9c:E 263 38 0.1170 0.0418 0.2895 3.8 5t91:A, 5t9b:G
6 5myj:BD 272 23 0.1277 0.0441 0.5217 4.7
7 5oas:A 728 20 0.1064 0.0137 0.5000 5.1 5vfb:A, 5vfb:B
8 5xxz:B 1310 34 0.1277 0.0092 0.3529 5.1
9 5xya:A 1358 34 0.1277 0.0088 0.3529 5.1 5xxz:A
10 7edd:A 1394 34 0.1277 0.0086 0.3529 5.2 5xyr:A
11 6vjb:A 1346 34 0.1277 0.0089 0.3529 5.3
12 3j3v:C 277 23 0.1277 0.0433 0.5217 5.4 7aqc:C, 7aqd:C, 7as8:E, 7as9:E, 8buu:C, 6ha1:C, 6ha8:C, 6htq:C, 3j3w:C, 3j9w:BD, 5njt:W, 7o5b:Z, 7ope:E, 6ppf:C, 6ppk:C, 6pvk:C, 8qcq:C, 7qgu:C, 7qh4:C, 8qpp:Z, 7qv1:C, 7qv2:C, 7qv3:C, 8r55:Z, 8s1p:C, 8s1u:C, 7s9u:C, 7sae:C, 6tnn:W, 6tpq:W
13 5imt:A 460 59 0.1383 0.0283 0.2203 6.6
14 8uu8:C 274 23 0.1170 0.0401 0.4783 7.5 8a57:G, 8a5i:G, 8a63:G, 7nhn:G, 8uu4:C, 8uu5:C, 8uu6:C, 8uu7:C, 8uu9:C, 8uua:C
15 4z0g:B 390 37 0.1489 0.0359 0.3784 7.8 4xtd:A, 4xtd:B, 4xti:A, 4xti:B, 4z0g:A
16 8ebw:H 532 40 0.1489 0.0263 0.3500 8.6 8ebs:H, 8ebt:H, 8ebv:H, 8ebx:H
17 8edi:A 200 23 0.1064 0.0500 0.4348 9.0 8edi:B
18 6o8w:C 275 23 0.1170 0.0400 0.4783 9.0 7nhk:G, 6o8x:C, 6o8y:C, 6o8z:C, 6o90:C, 7p7q:G, 7p7r:G, 7p7s:G, 7p7t:G, 7p7u:G, 6w6p:C
19 7cta:A 329 30 0.1170 0.0334 0.3667 9.1 7ct9:A, 7ct9:B, 7cta:B
20 6j2c:S 475 26 0.1170 0.0232 0.4231 9.3 6j2n:S, 6j2q:S, 6j2x:S, 6j30:S, 5wvi:S

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417