ENQAPVANFELKTDGLSVSAFNYSHDEDGELVSYAWDFGNGQMSSEMAPSWSYTRAGQYTVSLTVTDDKGATNTTTRTTQ
VEVP
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6aem:A | 84 | 84 | 1.0000 | 1.0000 | 1.0000 | 5.73e-59 | 6aem:B |
2 | 4l9d:B | 81 | 79 | 0.5952 | 0.6173 | 0.6329 | 5.26e-32 | |
3 | 4u7k:A | 86 | 59 | 0.3571 | 0.3488 | 0.5085 | 2.89e-16 | 4u7k:B, 4u7k:C, 4u7k:D, 4u7k:E, 4u7k:F, 4u7k:G, 4u7k:H |
4 | 4aqo:A | 86 | 85 | 0.4167 | 0.4070 | 0.4118 | 1.77e-15 | |
5 | 4jgu:A | 95 | 86 | 0.3810 | 0.3368 | 0.3721 | 7.97e-12 | 4jgu:B |
6 | 2c26:A | 250 | 88 | 0.4167 | 0.1400 | 0.3977 | 2.54e-10 | 2c4x:A |
7 | 6nz0:Z | 95 | 56 | 0.2500 | 0.2211 | 0.3750 | 8.37e-04 | |
8 | 2kpn:A | 97 | 52 | 0.2143 | 0.1856 | 0.3462 | 0.12 | |
9 | 7jrl:A | 457 | 64 | 0.2381 | 0.0438 | 0.3125 | 0.39 | 7jrm:A |
10 | 6hpf:A | 312 | 59 | 0.2143 | 0.0577 | 0.3051 | 1.5 | |
11 | 4efp:A | 235 | 43 | 0.1667 | 0.0596 | 0.3256 | 3.0 | 4efp:B, 4efq:A, 4efq:B |
12 | 6fj3:A | 562 | 24 | 0.1190 | 0.0178 | 0.4167 | 4.7 | 8d51:A, 8d52:A, 7uzo:A, 7uzp:A, 7uzp:C, 7uzp:E |
13 | 1z24:A | 189 | 63 | 0.2262 | 0.1005 | 0.3016 | 4.8 | |
14 | 4myp:A | 121 | 24 | 0.1071 | 0.0744 | 0.3750 | 6.3 | 4myp:B |
15 | 4i6v:B | 430 | 17 | 0.1190 | 0.0233 | 0.5882 | 7.1 | 4i6v:A, 4i6v:C |
16 | 4ejy:A | 289 | 32 | 0.1310 | 0.0381 | 0.3438 | 8.6 | 4ejy:B, 4ejz:A, 4ejz:B |
17 | 1l3w:A | 540 | 45 | 0.1905 | 0.0296 | 0.3556 | 8.6 | 1q55:A, 1q55:B, 1q55:C, 1q55:D, 1q5a:A, 1q5a:B, 1q5b:A, 1q5b:B, 1q5b:C, 1q5c:A, 1q5c:B, 1q5c:C, 1q5c:D |