BioLiP

Structure of PDB 5wlc Chain SL

Receptor sequence

>5wlcSL (length=174) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

TRKFGLVKRTLNTKKDQRLKKNQENTRNIPQVSSALFFQYNQAIKPPYQV
LIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLGPKYRI
ALKLARDPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLKQRIR
KIPGIPLMSVGGHAYVIEKLPDVF

3D structure

PDB

5wlc The complete structure of the small-subunit processome.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	SL	R42 I44 Q162 R163 R165	R27 I29 Q147 R148 R150
BS02	rna	SL	F10 R15 Q23 Y136	F4 R9 Q17 Y121
BS03	ZN	SL	C101 C130 H132 C140	C86 C115 H117 C125

Gene Ontology

	Molecular Function
GO:0004521	RNA endonuclease activity
GO:0004540	RNA nuclease activity
GO:0005515	protein binding
GO:0008270	zinc ion binding

	Biological Process
GO:0000447	endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364	rRNA processing
GO:0030490	maturation of SSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0032040	small-subunit processome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:5wlc, PDBe:5wlc, PDBj:5wlc
PDBsum	5wlc
PubMed	28945246
UniProt	Q05498\|FCF1_YEAST rRNA-processing protein FCF1 (Gene Name=FCF1)