
     
   
[
Home]
[
Forum]
[
Example
in Benchmark Mode]
[
Help]
Sequence Information of T2297kq8l(your_protein)
    
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICS NALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
|
The Input Parameters
Unit cell (a,b,c): | (79.6160,79.6160,137.5500) |
Unit cell (α,β,γ): | (90.0000,90.0000,120.0000)
|
Space Group: | P 65 2 2
|
Copy Number: | 1
|
Lowest Resolution: | 68.949
|
Highest Resolution: | 1.950
|
mtz file: | Download
|
Best Models with the lowest R-free
I-TASSER-MR Results of Sequence T2297kq8l
I-TASSER Models | I-TASSER-MR Models |
---|
Model1 |
|
- I-TASSER Models:the models predicted by I-TASSER;
- I-TASSER-MR Models: top 5 search models, MR models and refined models ranked by the final Rfreee of the refined models;
- Search Model: top 5 search models edited by progressive model truncation;
- MR Model: top 5 models produced by MR-REX from the corresponding top 5 search models;
- Starting Rwork: the starting Rwork of the refined models;
- Final Rwork: the final Rwork of the refined models;
- Starting Rfree: the starting Rfree of the refined models;
- Final Rfree: the final Rfree of the refined models.
|
I-TASSER Search Models for Sequence T2297kq8l
I-TASSER Models | Distribution of the AVS-score | Download |
---|
Model1 cscore:0.84 |  | Download |
|
- I-TASSER Models: the models predicted by I-TASSER;
- Download: the dowload file includes the AVS score file and all the edited search models;
|
Top 10 templates used by I-TASSER for Sequence T2297kq8l
Rank | Template | Aligned Length | Coverage | Z-score | Program | Alignments |
1 | 3daiA | 130 | 1.000 | 20.598 | MUSTER | Download |
2 | 5epb_A | 129 | 0.992 | 19.351 | HHpred_local | Download |
3 | 5e74a | 113 | 0.869 | 19.383 | SP3 | Download |
4 | 3daiA | 130 | 1.000 | 8.315 | PROSPECT2 | Download |
5 | 3daiA | 130 | 1.000 | 41.312 | PPA-I | Download |
6 | 5epb_A | 130 | 1.000 | 17.790 | HHpred_global | Download |
7 | 4nr9a | 113 | 0.869 | 18.539 | SPARKS2 | Download |
8 | 2dkwA | 125 | 0.962 | 17.643 | MUSTER | Download |
9 | 2dkw_A | 124 | 0.954 | 17.755 | HHpred_local | Download |
10 | 4nr9a | 113 | 0.869 | 19.352 | SP3 | Download |
- Rank of templates: represents the top ten threading templates used by I-TASSER;
- Aligned length: the number of aligned residues;
- Coverage: it represents the coverage of the threading alignment and is equal to the number of aligned residues divided by the length of query protein;
- Z-score: Z-score is the normalized Z-score of the threading alignment;
- Download Alignments: Provides the 3D structure of the aligned regions of the threading templates.
|
Download
References:
- Y. Wang, J. Virtanen, Z. Xue, Y. Zhang.
I-TASSER-MR: automated molecular replacement for proteins without close homologs using iterative
fragment assembly and progressive sequence truncation,
submitted (2017).
- Y. Wang, J. Virtanen, Z. Xue, J. J. G. Tesmer and Y. Zhang. Using iterative fragment assembly and progressive sequence truncation to facilitate phasing and crystal structure determination of distantly related proteins. Acta Cryst. (2016). D72, 616-628